SAXSdb — 1i84

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SMOOTH MUSCLE MYOSIN HEAVY CHAIN

Gallus gallus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain S； UniProt 1–1174 Chain V； UniProt 1–1174	Fragment：MEROMYOSIN SUBFRAGMENT. S1 AND S2 FRAGMENTS. Non-standard monomer：Yes (specific site not provided by mmCIF)	SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN × 2 SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN × 2 （P02609）	ELECTRON CRYSTALLOGRAPHY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE；Specimens were frozen in liquid ethane using a drop freezing apparatus. X-ray crystallization conditions：Lipid monolayer；pH 7.5；277 K；MgCl, sodium phosphate, ATP, EGTA, PEG 6000, pH 7.5, Lipid monolayer, temperature 277K	Resolution 20.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1I84	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BR1 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN-ESSENTIAL LIGHT CHAIN COMPLEX WITH MGADP.ALF4 BOUND AT THE ACTIVE SITE Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–818（817 aa） Fragment：CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；1.8M AMMONIUM SULFATE 100MM HEPES PH 7.2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 3.50 Å R-free 0.305
1BR1 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN-ESSENTIAL LIGHT CHAIN COMPLEX WITH MGADP.ALF4 BOUND AT THE ACTIVE SITE Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–818（817 aa） Fragment：CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；1.8M AMMONIUM SULFATE 100MM HEPES PH 7.2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 3.50 Å R-free 0.305
1BR1 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN-ESSENTIAL LIGHT CHAIN COMPLEX WITH MGADP.ALF4 BOUND AT THE ACTIVE SITE Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 2–818（817 aa） Fragment：CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；1.8M AMMONIUM SULFATE 100MM HEPES PH 7.2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 3.50 Å R-free 0.305
1BR1 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN-ESSENTIAL LIGHT CHAIN COMPLEX WITH MGADP.ALF4 BOUND AT THE ACTIVE SITE Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 2–818（817 aa） Fragment：CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；1.8M AMMONIUM SULFATE 100MM HEPES PH 7.2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 3.50 Å R-free 0.305
1BR2 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN COMPLEXED WITH MGADP.ALF4 Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–791（790 aa） Fragment：MOTOR DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；277 K；12% PEG8000 100MM IMIDAZOLE PH 6.8 150MM CACL2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 2.90 Å R-free 0.291
1BR2 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN COMPLEXED WITH MGADP.ALF4 Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–791（790 aa） Fragment：MOTOR DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；277 K；12% PEG8000 100MM IMIDAZOLE PH 6.8 150MM CACL2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 2.90 Å R-free 0.291
1BR2 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN COMPLEXED WITH MGADP.ALF4 Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2–791（790 aa） Fragment：MOTOR DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；277 K；12% PEG8000 100MM IMIDAZOLE PH 6.8 150MM CACL2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 2.90 Å R-free 0.291
1BR2 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN COMPLEXED WITH MGADP.ALF4 Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 2–791（790 aa） Fragment：MOTOR DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；277 K；12% PEG8000 100MM IMIDAZOLE PH 6.8 150MM CACL2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 2.90 Å R-free 0.291
1BR2 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN COMPLEXED WITH MGADP.ALF4 Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 2–791（790 aa） Fragment：MOTOR DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；277 K；12% PEG8000 100MM IMIDAZOLE PH 6.8 150MM CACL2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 2.90 Å R-free 0.291
1BR2 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN COMPLEXED WITH MGADP.ALF4 Deposited 1998-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 2–791（790 aa） Fragment：MOTOR DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；277 K；12% PEG8000 100MM IMIDAZOLE PH 6.8 150MM CACL2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 2.90 Å R-free 0.291
1BR4 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN-ESSENTIAL LIGHT CHAIN COMPLEX WITH MGADP.BEF3 BOUND AT THE ACTIVE SITE Deposited 1998-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–818（817 aa） Fragment：CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；1.8M AMMONIUM SULFATE 100MM HEPES PH 7.2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 3.62 Å R-free 0.352
1BR4 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN-ESSENTIAL LIGHT CHAIN COMPLEX WITH MGADP.BEF3 BOUND AT THE ACTIVE SITE Deposited 1998-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–818（817 aa） Fragment：CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；1.8M AMMONIUM SULFATE 100MM HEPES PH 7.2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 3.62 Å R-free 0.352
1BR4 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN-ESSENTIAL LIGHT CHAIN COMPLEX WITH MGADP.BEF3 BOUND AT THE ACTIVE SITE Deposited 1998-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 2–818（817 aa） Fragment：CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；1.8M AMMONIUM SULFATE 100MM HEPES PH 7.2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 3.62 Å R-free 0.352
1BR4 SMOOTH MUSCLE MYOSIN MOTOR DOMAIN-ESSENTIAL LIGHT CHAIN COMPLEX WITH MGADP.BEF3 BOUND AT THE ACTIVE SITE Deposited 1998-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 2–818（817 aa） Fragment：CHAINS A, C, E, G, MOTOR DOMAIN, CHAINS B, D, F, H, ESSENTIAL LIGHT	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；1.8M AMMONIUM SULFATE 100MM HEPES PH 7.2 2MM MGADP 2MM AL(NO3)3 8MM NAF PROTEIN CONCENTRATION: 10MG/ML TEMPERATURE: 4 DEGREES CENTIGRADE, temperature 277K	Resolution 3.62 Å R-free 0.352
3DTP Tarantula heavy meromyosin obtained by flexible docking to Tarantula muscle thick filament Cryo-EM 3D-MAP Deposited 2008-07-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions	Assembly 1 Insufficient information Heteromer；Protein × 216 PDB declaration: 216-meric	Chain A 3–852（850 aa） Fragment：SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-972),SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-972) Chain B 3–852（850 aa） Fragment：SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-974),SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-974)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 100mM NaCl, 3mM MgCl2, 1mM EGTA, 5mM PIPES, 5mM NaH2PO4, 1mM NaN3；pH 7；100mM NaCl, 3mM MgCl2, 1mM EGTA, 5mM PIPES, 5mM NaH2PO4, 1mM NaN3 cryo-EM vitrification conditions Plunging in a liquid ethane. Blotting was performed from one side of the grid till a thin sample film on it using Whatman No 42 filter paper, then the grid was immediately plunged under gravity into liquid ethane cooled by liquid nitrogen. Grids were stored under liquid nitrogen.	Resolution 20.00 Å
3DTP Tarantula heavy meromyosin obtained by flexible docking to Tarantula muscle thick filament Cryo-EM 3D-MAP Deposited 2008-07-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions	Assembly 2 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 3–852（850 aa） Fragment：SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-972),SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-972) Chain B 3–852（850 aa） Fragment：SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-974),SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-974)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 100mM NaCl, 3mM MgCl2, 1mM EGTA, 5mM PIPES, 5mM NaH2PO4, 1mM NaN3；pH 7；100mM NaCl, 3mM MgCl2, 1mM EGTA, 5mM PIPES, 5mM NaH2PO4, 1mM NaN3 cryo-EM vitrification conditions Plunging in a liquid ethane. Blotting was performed from one side of the grid till a thin sample film on it using Whatman No 42 filter paper, then the grid was immediately plunged under gravity into liquid ethane cooled by liquid nitrogen. Grids were stored under liquid nitrogen.	Resolution 20.00 Å
3DTP Tarantula heavy meromyosin obtained by flexible docking to Tarantula muscle thick filament Cryo-EM 3D-MAP Deposited 2008-07-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions	Assembly 3 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 3–852（850 aa） Fragment：SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-972),SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-972) Chain B 3–852（850 aa） Fragment：SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-974),SUBFRAGMENT 1(S1), DELTA-S2 (residues 2-974)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 100mM NaCl, 3mM MgCl2, 1mM EGTA, 5mM PIPES, 5mM NaH2PO4, 1mM NaN3；pH 7；100mM NaCl, 3mM MgCl2, 1mM EGTA, 5mM PIPES, 5mM NaH2PO4, 1mM NaN3 cryo-EM vitrification conditions Plunging in a liquid ethane. Blotting was performed from one side of the grid till a thin sample film on it using Whatman No 42 filter paper, then the grid was immediately plunged under gravity into liquid ethane cooled by liquid nitrogen. Grids were stored under liquid nitrogen.	Resolution 20.00 Å
3J04 EM structure of the heavy meromyosin subfragment of Chick smooth muscle Myosin with regulatory light chain in phosphorylated state Deposited 2011-02-18	Different construct Different mutation/modification Different experimental method Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 2–910（909 aa） Fragment：MEROMYOSIN SUBFRAGMENT Chain D 2–910（909 aa） Fragment：MEROMYOSIN SUBFRAGMENT	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；1 mM Mg, 20 mM phosphate, 1 mM ATP, 1 mM EGTA, 7-10% polyethylene glycol 6000, 90-120 mM NaCl cryo-EM vitrification conditions Blot for 4 sec before plunging；Cryogen ETHANE；Carried out in cold room at 4 degrees C X-ray crystallization conditions pH 7.8；pH 7.8	Resolution 20.00 Å
5M05 Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571 inhibitor, MgADP form Deposited 2016-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–790（790 aa）	Not recorded	52E 4-{[(2-chloro-3-fluorobenzyl)carbamoyl](methyl)amino}-3,4-dideoxy-5-O-(isoquinolin-3-ylcarbamoyl)-D-erythro-pentitol × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.2；277 K；Peg8K, 50 mM Bicine pH 8.2, 10% DMSO	Resolution 2.67 Å R-free 0.244
6BIH The Structure of the Actin-Smooth Muscle Myosin Motor Domain Complex in the Rigor State Deposited 2017-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain H 1–790（790 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 7 MG MAGNESIUM ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；actin buffer: 10 mM imidazole, 10 mM KCl, 1.0 mM MgCl2, 1.0 mM EGTA, 0.5 mM DTT, pH 7.4, myosin buffer: 10 mM imidazole, 10 mM KCl, 1.0 mM MgCl2, 1.0 mM EGTA, 0.5 mM DTT, pH 7.0 cryo-EM vitrification conditions Cryogen ETHANE；Some specimens were frozen manually using a homemade plunger.	Resolution 6.00 Å
6BIH The Structure of the Actin-Smooth Muscle Myosin Motor Domain Complex in the Rigor State Deposited 2017-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–790（790 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；actin buffer: 10 mM imidazole, 10 mM KCl, 1.0 mM MgCl2, 1.0 mM EGTA, 0.5 mM DTT, pH 7.4, myosin buffer: 10 mM imidazole, 10 mM KCl, 1.0 mM MgCl2, 1.0 mM EGTA, 0.5 mM DTT, pH 7.0 cryo-EM vitrification conditions Cryogen ETHANE；Some specimens were frozen manually using a homemade plunger.	Resolution 6.00 Å
7MF3 Structure of the autoinhibited state of smooth muscle myosin-2 Deposited 2021-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 2–1979（1978 aa） Chain B 2–1979（1978 aa） Chain G 2–1979（1978 aa） Chain H 2–1979（1978 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 PO4 PHOSPHATE ION × 2 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；150 mM NaCl, 1mM EGTA, 2mM MgCl2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å

8 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MYSG_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain S； PDBConstruct 1–1174； UniProt 1–1174 Author chain V； PDBConstruct 1–1174； UniProt 1–1174

SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN

Gallus gallus

UniProt P02609

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain U； UniProt 1–166 Chain Z； UniProt 1–166	Fragment：S1 FRAGMENT	SMOOTH MUSCLE MYOSIN HEAVY CHAIN × 2 （P10587） SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN × 2	ELECTRON CRYSTALLOGRAPHY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE；Specimens were frozen in liquid ethane using a drop freezing apparatus. X-ray crystallization conditions：Lipid monolayer；pH 7.5；277 K；MgCl, sodium phosphate, ATP, EGTA, PEG 6000, pH 7.5, Lipid monolayer, temperature 277K	Resolution 20.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1I84	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1M8Q Molecular Models of Averaged Rigor Crossbridges from Tomograms of Insect Flight Muscle Deposited 2002-07-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 26 PDB declaration: 26-meric	Chain B 19–163（145 aa） Chain E 19–163（145 aa） Chain H 19–163（145 aa） Chain Q 19–163（145 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions No vitrification. Samples were viewed at room temperature.	Resolution 70.00 Å
1MVW MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa） Chain N 29–164（136 aa） Chain Q 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O18 MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa） Chain N 29–164（136 aa） Chain Q 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O19 MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa） Chain N 29–164（136 aa） Chain T 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O1A MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa） Chain N 29–164（136 aa） Chain Q 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O1B MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 26 PDB declaration: 26-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O1C MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa） Chain Q 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O1D MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa） Chain N 29–164（136 aa） Chain Q 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O1E MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa） Chain N 29–164（136 aa） Chain Q 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O1F MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 26 PDB declaration: 26-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
1O1G MOLECULAR MODELS OF AVERAGED RIGOR CROSSBRIDGES FROM TOMOGRAMS OF INSECT FLIGHT MUSCLE Deposited 2002-11-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain B 29–164（136 aa） Chain E 29–164（136 aa） Chain H 29–164（136 aa） Chain K 29–164（136 aa） Chain N 29–164（136 aa） Chain Q 29–164（136 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions NO VITRIFICATION. SAMPLES WERE VIEWED AT ROOM TEMPERATURE.	Resolution 70.00 Å
2MYS MYOSIN SUBFRAGMENT-1, ALPHA CARBON COORDINATES ONLY FOR THE TWO LIGHT CHAINS Deposited 1996-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–166（166 aa） Fragment：SUBFRAGMENT-1	Not recorded	SO4 SULFATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
2W4A ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE Deposited 2008-11-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 16–165（150 aa） Fragment：RESIDUES, 16-165	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM	Resolution 35.00 Å
2W4G ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE QUICK FROZEN AFTER A QUICK STRETCH STEP Deposited 2008-11-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 16–165（150 aa） Fragment：RESIDUES, 16-165	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM；SMASH AGAINST A LIQUID HELIUM COOLED GOLD COATED COPPER MIRROR	Resolution 35.00 Å
2W4H Isometrically contracting insect asynchronous flight muscle quick frozen after a quick release step Deposited 2008-11-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 16–165（150 aa） Fragment：RESIDUES, 16-165	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS	Resolution 35.00 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MLRS_CHICK
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain U； PDBConstruct 1–166； UniProt 1–166 Author chain Z； PDBConstruct 1–166； UniProt 1–166

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1i84
Deposition date deposition_date	2001-03-12
Structure title title	CRYO-EM STRUCTURE OF THE HEAVY MEROMYOSIN SUBFRAGMENT OF CHICKEN GIZZARD SMOOTH MUSCLE MYOSIN WITH REGULATORY LIGHT CHAIN IN THE DEPHOSPHORYLATED STATE. ONLY C ALPHAS PROVIDED FOR REGULATORY LIGHT CHAIN. ONLY BACKBONE ATOMS PROVIDED FOR S2 FRAGMENT.
Keywords keywords	;muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain, regulatory light chain, motor protein, coiled-coil, CONTRACTILE PROTEIN ;; CONTRACTILE PROTEIN
Experimental Method method	ELECTRON CRYSTALLOGRAPHY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	54.89 Å
Radius of gyration Rg (electron density) rg_electron	54.63 Å
Forward intensity I(0) i0	1008540000.00
Molecular weight molecular_weight	262300.0 kDa
Excluded volume excluded_volume	325900 Å³
Envelope volume envelope_volume	515700 Å³
Hydration-shell volume shell_volume	79918 Å³
Envelope diameter envelope_diameter	174.6 Å
Shell Rg shell_rg	55.96 Å
Envelope Rg envelope_rg	52.71 Å
Shape Rg shape_rg	52.83 Å
Total Rg total_rg	59.80 Å
Total atoms total_atoms	16304
Residues n_residues	2106
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	172.8 Å
Rg (real space) rg_real	54.76 Å
Rg uncertainty (real space) rg_real_error	1.52 Å
I(0) (real space) i0_real	1.0090e+09
I(0) uncertainty (real space) i0_real_error	2.0510e+07
Rg (reciprocal space) rg_reciprocal	54.97 Å
I(0) (reciprocal space) i0_reciprocal	1009000000.0000
Solution quality estimate total_estimate	0.8845
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	77.5 Å
Skewness Skewness skewness	0.087
Kurtosis Kurtosis kurtosis	-0.737
Angular range angular_range	— – 0.1450 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	65440000.0000
Real-space data points n_real_points	30
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.964; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.604

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	SMOOTH MUSCLE MYOSIN HEAVY CHAIN
Molecular weight formula_weight	137072.9 kDa
EC 编号 ec_number	3.6.1.32
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,V
Atom count atom_count	16580

AQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVELQENGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQMRNDLLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALLDEECWFPKATDTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKNMDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIIAFQAQCRGYLARKAFAKRQQQLESIFCIQYNVRSFMNVKHWPWMKLFFKIKPLLKVTRQEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKDDDDK

来源 Source

来源生物 organism	Gallus gallus
通用名 common_name	chicken
NCBI Class编号 ncbi_taxonomy_id	9031
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN
Molecular weight formula_weight	16873.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,W

CDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG

来源 Source

来源生物 organism	Gallus gallus
通用名 common_name	chicken
NCBI Class编号 ncbi_taxonomy_id	9031
宿主生物 host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN
Molecular weight formula_weight	18329.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,Z

PKKAKRRAAEGSSNVFSMFDETEIEDFKEAFTVIDQNADGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINFTVFLTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTGGGRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHGEDAEGE

来源 Source

来源生物 organism	Gallus gallus
通用名 common_name	chicken
NCBI Class编号 ncbi_taxonomy_id	9031
宿主生物 host_organism	Spodoptera frugiperda

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1i84s_
Class class	i — Low resolution protein structures
Fold Fold fold	i.15 — Muscle protein complexes
Superfamily Superfamily superfamily	i.15.1 — Muscle protein complexes
Family Family family	i.15.1.1 — Muscle protein complexes

Domain ID domain_id	d1i84t_
Class class	i — Low resolution protein structures
Fold Fold fold	i.15 — Muscle protein complexes
Superfamily Superfamily superfamily	i.15.1 — Muscle protein complexes
Family Family family	i.15.1.1 — Muscle protein complexes

Domain ID domain_id	d1i84u_
Class class	i — Low resolution protein structures
Fold Fold fold	i.15 — Muscle protein complexes
Superfamily Superfamily superfamily	i.15.1 — Muscle protein complexes
Family Family family	i.15.1.1 — Muscle protein complexes

Domain ID domain_id	d1i84v_
Class class	i — Low resolution protein structures
Fold Fold fold	i.15 — Muscle protein complexes
Superfamily Superfamily superfamily	i.15.1 — Muscle protein complexes
Family Family family	i.15.1.1 — Muscle protein complexes

Domain ID domain_id	d1i84w_
Class class	i — Low resolution protein structures
Fold Fold fold	i.15 — Muscle protein complexes
Superfamily Superfamily superfamily	i.15.1 — Muscle protein complexes
Family Family family	i.15.1.1 — Muscle protein complexes

Domain ID domain_id	d1i84z_
Class class	i — Low resolution protein structures
Fold Fold fold	i.15 — Muscle protein complexes
Superfamily Superfamily superfamily	i.15.1 — Muscle protein complexes
Family Family family	i.15.1.1 — Muscle protein complexes

▶

8. Citations (5)

▶

Unit-cell length a length_a	133.000 Å
Unit-cell length b length_b	304.000 Å
Unit-cell length c length_c	200.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	91.50 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 1 2
Space-group number int_tables_number	3
Crystal system crystal_system	—

Resolution resolution	20.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	20.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	—

fit	/app/data/saxs_computation/i8/1i84/1i84.fit
pddf	/app/data/pr_computation/i8/1i84/1i84.pr.out
profile	/app/data/saxs_computation/i8/1i84/1i84.dat

CRYO-EM STRUCTURE OF THE HEAVY MEROMYOSIN SUBFRAGMENT OF CHICKEN GIZZARD SMOOTH MUSCLE MYOSIN WITH REGULATORY LIGHT CHAIN IN THE DEPHOSPHORYLATED STATE. ONLY C ALPHAS PROVIDED FOR REGULATORY LIGHT CHAIN. ONLY BACKBONE ATOMS PROVIDED FOR S2 FRAGMENT.

1. Protein Identity and Related Structures Protein Identity & Related Structures

SMOOTH MUSCLE MYOSIN HEAVY CHAIN

State in the Current Structure

Other States of the Same Protein in the Database

SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (6 domains)

8. Citations (5)

9. Files and Curves (10)

Files (7)

Curves (3)