1p8x

The Calcium-Activated C-terminal half of gelsolin

Method: X-RAY DIFFRACTION D_max: 120.7 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gelsolin precursor, plasma

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 439–782	Fragment：C-terminal domain	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；277.15 K；15% (w/v) PEG 8000, 100 mM Tris-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 2.00 Å R-free 0.245
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 439–782	Fragment：C-terminal domain	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；277.15 K；15% (w/v) PEG 8000, 100 mM Tris-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 2.00 Å R-free 0.245
3	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain C； UniProt 439–782	Fragment：C-terminal domain	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；277.15 K；15% (w/v) PEG 8000, 100 mM Tris-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 2.00 Å R-free 0.245

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1P8X	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1C0F CRYSTAL STRUCTURE OF DICTYOSTELIUM CAATP-ACTIN IN COMPLEX WITH GELSOLIN SEGMENT 1 Deposited 1999-07-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 53–176（124 aa）	Mutation：N35C	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；290 K；IMIDAZOLE, SODIUM CHLORIDE, ATP, CALCIUM CHLORIDE, MAGNESIUM CHLORIDE, SODIUM AZIDE, DITHIOTHREITOL, PEG 6000, pH 6.6, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.40 Å R-free 0.231
1C0G CRYSTAL STRUCTURE OF 1:1 COMPLEX BETWEEN GELSOLIN SEGMENT 1 AND A DICTYOSTELIUM/TETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228K/T229A/A230Y/E360H) Deposited 1999-07-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 53–176（124 aa）	Mutation：YES	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；295 K；MES, SODIUM CHLORIDE, ATP, CALCIUM CHLORIDE, MAGNESIUM CHLORIDE, SODIUM AZIDE, DITHIOTHREITOL, PEG 6000, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.00 Å R-free 0.223
1D4X Crystal Structure of Caenorhabditis Elegans Mg-ATP Actin Complexed with Human Gelsolin Segment 1 at 1.75 A resolution. Deposited 1999-10-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–177（126 aa） Fragment：SEGMENT 1	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 SO2 SULFUR DIOXIDE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；100 MM TRIS-HCL, PH 8.0, 2 MM MG-ATP, 1.60 M LI2SO4,, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.75 Å R-free 0.233
1D4X Crystal Structure of Caenorhabditis Elegans Mg-ATP Actin Complexed with Human Gelsolin Segment 1 at 1.75 A resolution. Deposited 1999-10-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–177（126 aa） Fragment：SEGMENT 1	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 SO2 SULFUR DIOXIDE × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；100 MM TRIS-HCL, PH 8.0, 2 MM MG-ATP, 1.60 M LI2SO4,, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.75 Å R-free 0.233
1DEJ CRYSTAL STRUCTURE OF A DICTYOSTELIUM/TETRAHYMENA CHIMERA ACTIN (MUTANT 646: Q228K/T229A/A230Y/A231K/S232E/E360H) IN COMPLEX WITH HUMAN GELSOLIN SEGMENT 1 Deposited 1999-11-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 53–176（124 aa） Fragment：SEGMENT 1	Mutation：YES	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；MES, NACL, CACL2, MGCL2, ATP, PEG6000, DTT, NAN3, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.214
1EQY COMPLEX BETWEEN RABBIT MUSCLE ALPHA-ACTIN: HUMAN GELSOLIN DOMAIN 1 Deposited 2000-04-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 52–176（125 aa） Fragment：DOMAIN 1	Mutation：N33C	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.6；298 K；PEG 6000, sodium chloride, adenosine triphosphate, calcium, magnesium, sodium azide, pH 6.6, Vapor Diffusion, temperature 298.0K	Resolution 2.30 Å R-free 0.280
1ESV COMPLEX BETWEEN LATRUNCULIN A:RABBIT MUSCLE ALPHA ACTIN:HUMAN GELSOLIN DOMAIN 1 Deposited 2000-04-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 52–176（125 aa） Fragment：DOMAIN 1	Mutation：N33C	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 LAR LATRUNCULIN A × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.6；298 K；PEG 6000, sodium Chloride, adenosine triphosphate, calcium, magnesium, sodium azide, pH 6.6, VAPOR DIFFUSION, temperature 298.0K	Resolution 2.00 Å R-free 0.286
1H1V gelsolin G4-G6/actin complex Deposited 2002-07-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 439–769（331 aa） Fragment：G4-G6, RESIDUES 412-742 OF CYTOPLASMIC ISOFORM	Not recorded	CA CALCIUM ION × 5 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；PROTEIN WAS CRYSTALLIZED FROM 100MM HEPES BUFFER, PH 7.5, 20% GLYCEROL, 10 % PEG 8000	Resolution 2.99 Å R-free 0.268
1KCQ Human Gelsolin Domain 2 with a Cd2+ bound Deposited 2001-11-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 185–288（104 aa） Fragment：DOMAIN 2	Not recorded	CD CADMIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；290 K；PEG 400, cadmium chloride, sodium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP at 290K	Resolution 1.65 Å R-free 0.233
1KCQ Human Gelsolin Domain 2 with a Cd2+ bound Deposited 2001-11-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 185–288（104 aa） Fragment：DOMAIN 2	Not recorded	CD CADMIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；290 K；PEG 400, cadmium chloride, sodium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP at 290K	Resolution 1.65 Å R-free 0.233
1MDU Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1) Deposited 2002-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 52–176（125 aa） Fragment：actin-severing	Not recorded	CA CALCIUM ION × 12 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；PEG 3350, tris, calcium chloride, magnesium chloride, ADP, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.233
1MDU Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1) Deposited 2002-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 52–176（125 aa） Fragment：actin-severing	Not recorded	CA CALCIUM ION × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；PEG 3350, tris, calcium chloride, magnesium chloride, ADP, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.233
1NLV Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human Gelsolin Segment 1 Deposited 2003-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–176（125 aa） Fragment：DOMAIN 1	Not recorded	CA CALCIUM ION × 2 SO4 SULFATE ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 SO2 SULFUR DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；lithium chloride, magnesium chloride, HEPES, ATP, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.258
1NLV Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human Gelsolin Segment 1 Deposited 2003-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–176（125 aa） Fragment：DOMAIN 1	Not recorded	CA CALCIUM ION × 4 SO4 SULFATE ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 SO2 SULFUR DIOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；lithium chloride, magnesium chloride, HEPES, ATP, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.258
1NM1 Crystal Structure of D. Dicsoideum Actin Complexed With Gelsolin Segment 1 and Mg ATP at 1.8 A Resolution Deposited 2003-01-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–176（125 aa） Fragment：DOMAIN 1	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 SO2 SULFUR DIOXIDE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；Magnesium chloride, litheim chloride, HEPES, ATP, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.232
1NM1 Crystal Structure of D. Dicsoideum Actin Complexed With Gelsolin Segment 1 and Mg ATP at 1.8 A Resolution Deposited 2003-01-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–176（125 aa） Fragment：DOMAIN 1	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 SO2 SULFUR DIOXIDE × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；Magnesium chloride, litheim chloride, HEPES, ATP, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.232
1NMD Crystal Structure of D. Discoideum Actin-Gelsolin Segment 1 Complex Crystallized In Presence Of Lithium ATP Deposited 2003-01-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–176（125 aa） Fragment：domain I	Not recorded	SO4 SULFATE ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 SO2 SULFUR DIOXIDE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；300 K；Lithium sulfate, HEPES, ATP, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 1.90 Å R-free 0.250
1NMD Crystal Structure of D. Discoideum Actin-Gelsolin Segment 1 Complex Crystallized In Presence Of Lithium ATP Deposited 2003-01-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–176（125 aa） Fragment：domain I	Not recorded	SO4 SULFATE ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 SO2 SULFUR DIOXIDE × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；300 K；Lithium sulfate, HEPES, ATP, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 1.90 Å R-free 0.250
1P8Z Complex Between Rabbit Muscle alpha-Actin: Human Gelsolin Residues Val26-Glu156 Deposited 2003-05-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–187（136 aa）	Not recorded	CD CADMIUM ION × 3 CA CALCIUM ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1M Sodium Acetate, 10 mM Cadmium Chloride, 12.5% (v/v) PEG 400, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.263
1P8Z Complex Between Rabbit Muscle alpha-Actin: Human Gelsolin Residues Val26-Glu156 Deposited 2003-05-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–187（136 aa）	Not recorded	CD CADMIUM ION × 6 CA CALCIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1M Sodium Acetate, 10 mM Cadmium Chloride, 12.5% (v/v) PEG 400, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.263
1SOL A PIP2 AND F-ACTIN-BINDING SITE OF GELSOLIN, RESIDUE 150-169 (NMR, AVERAGED STRUCTURE) Deposited 1995-09-29	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 177–196（20 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1T44 Structural basis of actin sequestration by thymosin-B4: Implications for arp2/3 activation Deposited 2004-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 55–179（125 aa） Fragment：Chimera of Gelsolin domain 1 (residues 28-152) from human and C-Terminal domain of thymosin Beta-4 from mouse (residues 153-171)	Not recorded	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 6.5；293 K；PEG 8000, Sodium acetate, calcium chloride, pH 6.5, microbatch, temperature 293K	Resolution 2.00 Å R-free 0.195
1YAG STRUCTURE OF THE YEAST ACTIN-HUMAN GELSOLIN SEGMENT 1 COMPLEX Deposited 1998-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–176（125 aa） Fragment：SUBDOMAIN 1	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.50	Resolution 1.90 Å R-free 0.231
1YAG STRUCTURE OF THE YEAST ACTIN-HUMAN GELSOLIN SEGMENT 1 COMPLEX Deposited 1998-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–176（125 aa） Fragment：SUBDOMAIN 1	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.50	Resolution 1.90 Å R-free 0.231
1YVN THE YEAST ACTIN VAL 159 ASN MUTANT COMPLEX WITH HUMAN GELSOLIN SEGMENT 1. Deposited 1999-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–176（125 aa） Fragment：FRAGMENT 1	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；0.1 M HEPES, 1.60 M (NH4)2SO4, 2 MM MG-ATP, PH=8.0.	Resolution 2.10 Å R-free 0.235
1YVN THE YEAST ACTIN VAL 159 ASN MUTANT COMPLEX WITH HUMAN GELSOLIN SEGMENT 1. Deposited 1999-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–176（125 aa） Fragment：FRAGMENT 1	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；0.1 M HEPES, 1.60 M (NH4)2SO4, 2 MM MG-ATP, PH=8.0.	Resolution 2.10 Å R-free 0.235
2FF3 Crystal structure of Gelsolin domain 1:N-wasp V2 motif hybrid in complex with actin Deposited 2005-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 52–179（128 aa） Fragment：Gelsolin domain 1	Not recorded	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 6.5；293.15 K；5% PEG 8000, 0.1M sodium acetate, 10mM calcium chloride, pH 6.5, microbatch, temperature 293.15K	Resolution 2.00 Å R-free 0.250
2FF6 Crystal structure of Gelsolin domain 1:ciboulot domain 2 hybrid in complex with actin Deposited 2005-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 51–178（128 aa） Fragment：Gelsolin domain 1	Not recorded	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293.15 K；7% PEG 3000, 0.1M Hepes, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293.15K	Resolution 2.05 Å R-free 0.237
2FH1 C-terminal half of gelsolin soaked in low calcium at pH 4.5 Deposited 2005-12-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 1.55 Å R-free 0.214
2FH1 C-terminal half of gelsolin soaked in low calcium at pH 4.5 Deposited 2005-12-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 1.55 Å R-free 0.214
2FH1 C-terminal half of gelsolin soaked in low calcium at pH 4.5 Deposited 2005-12-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 1.55 Å R-free 0.214
2FH2 C-terminal half of gelsolin soaked in EGTA at pH 4.5 Deposited 2005-12-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 2.50 Å R-free 0.255
2FH2 C-terminal half of gelsolin soaked in EGTA at pH 4.5 Deposited 2005-12-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 2.50 Å R-free 0.255
2FH2 C-terminal half of gelsolin soaked in EGTA at pH 4.5 Deposited 2005-12-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 2.50 Å R-free 0.255
2FH3 C-terminal half of gelsolin soaked in low calcium at pH 8 Deposited 2005-12-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 2.87 Å R-free 0.262
2FH3 C-terminal half of gelsolin soaked in low calcium at pH 8 Deposited 2005-12-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 2.87 Å R-free 0.262
2FH3 C-terminal half of gelsolin soaked in low calcium at pH 8 Deposited 2005-12-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 2.87 Å R-free 0.262
2FH4 C-terminal half of gelsolin soaked in EGTA at pH 8 Deposited 2005-12-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 3.00 Å R-free 0.310
2FH4 C-terminal half of gelsolin soaked in EGTA at pH 8 Deposited 2005-12-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 3.00 Å R-free 0.310
2FH4 C-terminal half of gelsolin soaked in EGTA at pH 8 Deposited 2005-12-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 439–782（344 aa） Fragment：C-terminal half domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions micro batch under oil；pH 4.5；277 K；PEG 8000, pH 4.5, micro batch under oil, temperature 277K	Resolution 3.00 Å R-free 0.310
3A5L Crystal Structure of a Dictyostelium P109A Mg2+-Actin in Complex with Human Gelsolin Segment 1 Deposited 2009-08-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 53–176（124 aa） Fragment：GELSOLIN-LIKE 1, residues 53-176	Mutation：N35C	CA CALCIUM ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.207
3A5M Crystal Structure of a Dictyostelium P109I Mg2+-Actin in Complex with Human Gelsolin Segment 1 Deposited 2009-08-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 53–176（124 aa） Fragment：GELSOLIN-LIKE 1, residues 53-176	Mutation：N35C	CA CALCIUM ION × 2 MG MAGNESIUM ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.223
3A5N Crystal Structure of a Dictyostelium P109A Ca2+-Actin in Complex with Human Gelsolin Segment 1 Deposited 2009-08-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 53–176（124 aa） Fragment：GELSOLIN-LIKE 1, residues 53-176	Mutation：N35C	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.36 Å R-free 0.204
3A5O Crystal Structure of a Dictyostelium P109I Ca2+-Actin in Complex with Human Gelsolin Segment 1 Deposited 2009-08-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 53–176（124 aa） Fragment：GELSOLIN-LIKE 1, residues 53-176	Mutation：N35C	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.207
3CI5 Complex of Phosphorylated Dictyostelium Discoideum Actin with Gelsolin Deposited 2008-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–176（125 aa） Fragment：Gelsolin Segment 1 (UNP residues 52-176)	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 10 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GOL GLYCEROL × 5 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M HEPES, 1.7M Li2SO4, 2mM ATP, 1mM EDTA, 10% Glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.70 Å R-free 0.191
3CI5 Complex of Phosphorylated Dictyostelium Discoideum Actin with Gelsolin Deposited 2008-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–176（125 aa） Fragment：Gelsolin Segment 1 (UNP residues 52-176)	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 20 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 GOL GLYCEROL × 10 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M HEPES, 1.7M Li2SO4, 2mM ATP, 1mM EDTA, 10% Glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.70 Å R-free 0.191
3CIP Complex of Dictyostelium Discoideum Actin with Gelsolin Deposited 2008-03-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–176（125 aa） Fragment：Gelsolin Segment 1 (UNP RESIDUES 52-176)	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GOL GLYCEROL × 3 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M HEPES, pH7.5, 1.7M Li2SO4, 2mM ATP, 1mM EDTA, 5% Glycerol, vapor diffusion, hanging drop, temperature 293K	Resolution 1.60 Å R-free 0.197
3CIP Complex of Dictyostelium Discoideum Actin with Gelsolin Deposited 2008-03-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 52–176（125 aa） Fragment：Gelsolin Segment 1 (UNP RESIDUES 52-176)	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 18 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 GOL GLYCEROL × 6 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M HEPES, pH7.5, 1.7M Li2SO4, 2mM ATP, 1mM EDTA, 5% Glycerol, vapor diffusion, hanging drop, temperature 293K	Resolution 1.60 Å R-free 0.197
3CJB Actin dimer cross-linked by V. cholerae MARTX toxin and complexed with Gelsolin-segment 1 Deposited 2008-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 52–176（125 aa） Fragment：segment 1	Not recorded	CA CALCIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；10% Peg MME 5000, 5% Tacsimate, 0.1 M Hepes, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.21 Å R-free 0.269
3CJC Actin dimer cross-linked by V. cholerae MARTX toxin and complexed with DNase I and Gelsolin-segment 1 Deposited 2008-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 52–176（125 aa） Fragment：segment 1	Not recorded	CA CALCIUM ION × 2 SO4 SULFATE ION × 6 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；1.5 M (NH4)SO4, 0.1 M Bis-Tris, 0.1 M NaCl, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.90 Å R-free 0.278
3FFK Crystal structure of human Gelsolin domains G1-G3 bound to Actin Deposited 2008-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 52–426（375 aa） Fragment：UNP residues 52-426	Not recorded	CA CALCIUM ION × 5 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；297 K；9% PEG 4000, 100 mM Sodium Acetate, 100 mM Calcium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 3.00 Å R-free 0.273
3FFK Crystal structure of human Gelsolin domains G1-G3 bound to Actin Deposited 2008-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 52–426（375 aa） Fragment：UNP residues 52-426	Not recorded	CA CALCIUM ION × 5 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；297 K；9% PEG 4000, 100 mM Sodium Acetate, 100 mM Calcium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 3.00 Å R-free 0.273
3FFN Crystal structure of calcium-free human gelsolin Deposited 2008-12-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–782（782 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；297 K；15% glycerol, 100 mM Bis-Tris HCl, 1.5M ammonium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 3.00 Å R-free 0.271
3FFN Crystal structure of calcium-free human gelsolin Deposited 2008-12-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–782（782 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；297 K；15% glycerol, 100 mM Bis-Tris HCl, 1.5M ammonium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 3.00 Å R-free 0.271
3TU5 Actin complex with Gelsolin Segment 1 fused to Cobl segment Deposited 2011-09-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 53–174（122 aa）	Not recorded	CA CALCIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；298 K；10% (w/v) polyethyleneglycol 20000, 2% (v/v) dioxane, and 0.1M bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.00 Å R-free 0.204
4PKG Complex of ATP-actin With the N-terminal Actin-Binding Domain of Tropomodulin Deposited 2014-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 12–136（125 aa） Fragment：Gelsolin (UNP residues 12-136), GGSGGSGGS linker, Tmod1 Actin-binding site 1 (UNP residues 50-101)	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；0.18 M sodium fluoride, 11% w/v PEG3350, 1% v/v PEG1000, 1% v/v PEG400	Resolution 1.80 Å R-free 0.187
4PKH Complex of ADP-actin With the N-terminal Actin-Binding Domain of Tropomodulin Deposited 2014-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 12–136（125 aa） Fragment：Gelsolin (UNP residues 12-136), GGSGGSGGS linker, Tmod1 Actin-binding site 1 (UNP residues 50-101)	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；0.18 M sodium fluoride, 11% w/v PEG3350, 1% v/v PEG1000, 1% v/v PEG400	Resolution 2.15 Å R-free 0.326
4PKH Complex of ADP-actin With the N-terminal Actin-Binding Domain of Tropomodulin Deposited 2014-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 12–136（125 aa） Fragment：Gelsolin (UNP residues 12-136), GGSGGSGGS linker, Tmod1 Actin-binding site 1 (UNP residues 50-101)	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；0.18 M sodium fluoride, 11% w/v PEG3350, 1% v/v PEG1000, 1% v/v PEG400	Resolution 2.15 Å R-free 0.326
4PKH Complex of ADP-actin With the N-terminal Actin-Binding Domain of Tropomodulin Deposited 2014-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 12–136（125 aa） Fragment：Gelsolin (UNP residues 12-136), GGSGGSGGS linker, Tmod1 Actin-binding site 1 (UNP residues 50-101)	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；0.18 M sodium fluoride, 11% w/v PEG3350, 1% v/v PEG1000, 1% v/v PEG400	Resolution 2.15 Å R-free 0.326
4PKH Complex of ADP-actin With the N-terminal Actin-Binding Domain of Tropomodulin Deposited 2014-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 12–136（125 aa） Fragment：Gelsolin (UNP residues 12-136), GGSGGSGGS linker, Tmod1 Actin-binding site 1 (UNP residues 50-101)	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；0.18 M sodium fluoride, 11% w/v PEG3350, 1% v/v PEG1000, 1% v/v PEG400	Resolution 2.15 Å R-free 0.326
4PKI Complex of ATP-actin With the C-terminal Actin-Binding Domain of Tropomodulin Deposited 2014-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 12–136（125 aa） Fragment：Gelsolin (UNP residues 12-136), GGSGGSGGS linker, Tmod1 Actin-binding site 2 (UNP residues 160-349)	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；0.25 M sodium chloride, 12% w/v PEG3350	Resolution 2.30 Å R-free 0.201
4S10 Gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis Deposited 2015-01-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 186–288（103 aa） Fragment：GELSOLIN DOMAIN 2	Mutation：S226D, R228D	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；288 K；30% PEG 1500, VAPOR DIFFUSION, temperature 288K	Resolution 2.61 Å R-free 0.312
4S10 Gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis Deposited 2015-01-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 186–288（103 aa） Fragment：GELSOLIN DOMAIN 2	Mutation：S226D, R228D	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；288 K；30% PEG 1500, VAPOR DIFFUSION, temperature 288K	Resolution 2.61 Å R-free 0.312
4Z94 Actin Complex With a Chimera of Tropomodulin-1 and Leiomodin-1 Actin-Binding Site 2 Deposited 2015-04-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 12–136（125 aa） Fragment：;Gelsolin residues 12-136 (UNP), linker,Tropomodulin-1 residues 160-228 (UNP), Leiomodin-1 Actin-Binding Site 2 (UNP residues 364-486) ;	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；291.5 K；20% PEG3350, 200 mM lithium sulfate, 100 mM Tris, pH 8.8, 15% glycerol	Resolution 2.40 Å R-free 0.243
5FAE N184K pathological variant of gelsolin domain 2 (trigonal form) Deposited 2015-12-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 178–293（116 aa） Fragment：UNP residues 178-293	Mutation：N184K	CA CALCIUM ION × 1 SO4 SULFATE ION × 4 PEG DI(HYDROXYETHYL)ETHER × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.2 M lithium sulfate 0.1 M tris 40% PEG 400	Resolution 1.70 Å R-free 0.225
5FAF N184K pathological variant of gelsolin domain 2 (orthorhombic form) Deposited 2015-12-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 178–293（116 aa） Fragment：UNP residues 178-293	Mutation：N184K	CA CALCIUM ION × 2 GOL GLYCEROL × 3 CL CHLORIDE ION × 2 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；20% PEG 8000 0.1 M MES 0.2 M calcium acetate	Resolution 1.05 Å R-free 0.168
5H3M Solution structure of human Gelsolin protein domain 1 at pH 5.0 Deposited 2016-10-26	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 55–187（133 aa） Fragment：UNP residues 55-187	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5；298 K；Ionic strength (raw mmCIF value) 0；Pressure 1 NMR sample composition 0.65 mM 13C, 15N gelsolin domain 1, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
5H3N Solution structure of human Gelsolin protein domain 1 at pH 7.3 Deposited 2016-10-26	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 55–187（133 aa） Fragment：UNP residues 55-187	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.3；298 K；Ionic strength (raw mmCIF value) 0；Pressure 1 NMR sample composition 0.70 mM 13C, 15N human Gelsolin, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
5O2Z Domain swap dimer of the G167R variant of gelsolin second domain Deposited 2017-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 178–293（116 aa） Chain B 178–293（116 aa）	Mutation：G167R Mutation：G167R	CA CALCIUM ION × 2 FLC CITRATE ANION × 2 ACT ACETATE ION × 2 NA SODIUM ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；0.2M ammonium acetate, 0.1M sodium citrate, 30% PEG 4000	Resolution 1.70 Å R-free 0.242
5UBO Mical-oxidized Actin complex with Gelsolin Segment 1 Deposited 2016-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 12–138（127 aa） Fragment：unp residues 12-138	Not recorded	CA CALCIUM ION × 3 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；298 K；PEG 6000, NaCl, imidazole, ATP, calcium	Resolution 2.39 Å R-free 0.191
5ZZ0 HUMAN GELSOLIN FROM RESIDUES GLU28 TO ARG161 WITH CALCIUM Deposited 2018-05-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 55–188（134 aa） Fragment：UNP residues 55-188	Not recorded	CA CALCIUM ION × 2 PG0 2-(2-METHOXYETHOXY)ETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Peg 6000 (20%), 100mM Sodium acetate, 200mM Calcium Chloride Dihydrate, pH 5	Resolution 2.63 Å R-free 0.254
5ZZ0 HUMAN GELSOLIN FROM RESIDUES GLU28 TO ARG161 WITH CALCIUM Deposited 2018-05-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 55–188（134 aa） Fragment：UNP residues 55-188	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Peg 6000 (20%), 100mM Sodium acetate, 200mM Calcium Chloride Dihydrate, pH 5	Resolution 2.63 Å R-free 0.254
6H1F Structure of the nanobody-stabilized gelsolin D187N variant (second domain) Deposited 2018-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 178–293（116 aa）	Mutation：D187N	SCN THIOCYANATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；0.1 M Potassium thiocyanate, 30%w/v PEG 2000 MME	Resolution 1.90 Å R-free 0.233
6JCO Crystal structure of calcium free human gelsolin amyloid mutant D187N Deposited 2019-01-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 56–782（727 aa） Chain B 56–782（727 aa）	Mutation：D187N Mutation：D187N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；298.1 K；15% glycerol, 1.5M ammonium sulfate, 0.1M tris HCl pH8.5	Resolution 2.88 Å R-free 0.267
6JEG Crystal structure of calcium free human gelsolin amyloid mutant G167R Deposited 2019-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 54–782（729 aa） Chain B 54–782（729 aa）	Mutation：G167R Mutation：G167R	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；298 K；15% glycerol, 1.5M ammonium sulfate, 0.1M tris HCl, pH8.5	Resolution 2.98 Å R-free 0.237
6JEH Crystal structure of calcium free human gelsolin amyloid mutant D187Y Deposited 2019-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 56–782（727 aa） Chain B 56–782（727 aa）	Mutation：D187Y Mutation：D187Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；298 K；15% glycerol, 1.5M ammonium sulfate, 0.1M tris HCl pH8.5	Resolution 2.95 Å R-free 0.249
6LJE Crystal structure of gelsolin G3 domain (calcium and magnesium condition) Deposited 2019-12-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 297–397（101 aa） Fragment：UNP residues 297-397	Not recorded	GOL GLYCEROL × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, ammonium sulphate, calcium chloride, magnesium chloride	Resolution 1.40 Å R-free 0.189
6LJE Crystal structure of gelsolin G3 domain (calcium and magnesium condition) Deposited 2019-12-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 297–397（101 aa） Fragment：UNP residues 297-397	Not recorded	GOL GLYCEROL × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, ammonium sulphate, calcium chloride, magnesium chloride	Resolution 1.40 Å R-free 0.189
6LJF Crystal structure of gelsolin G3 domain (calcium condition) Deposited 2019-12-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 297–397（101 aa） Fragment：UNP residues 297-397	Not recorded	CA CALCIUM ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, ammonium sulphate, calcium chloride	Resolution 1.50 Å R-free 0.183
6LJF Crystal structure of gelsolin G3 domain (calcium condition) Deposited 2019-12-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 297–397（101 aa） Fragment：UNP residues 297-397	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, ammonium sulphate, calcium chloride	Resolution 1.50 Å R-free 0.183
6Q9R Crystal structure of the pathological N184K variant of calcium-free human gelsolin Deposited 2018-12-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 28–782（755 aa）	Mutation：N184K	CL CHLORIDE ION × 6 GOL GLYCEROL × 8 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；1.5 M ammonium sulfate, 15 % glycerol, 100 mM Tris-HCl	Resolution 2.73 Å R-free 0.260
6Q9R Crystal structure of the pathological N184K variant of calcium-free human gelsolin Deposited 2018-12-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 28–782（755 aa）	Mutation：N184K	CL CHLORIDE ION × 3 GOL GLYCEROL × 9 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；1.5 M ammonium sulfate, 15 % glycerol, 100 mM Tris-HCl	Resolution 2.73 Å R-free 0.260
6Q9Z Crystal structure of the pathological G167R variant of calcium-free human gelsolin, Deposited 2018-12-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 28–782（755 aa）	Mutation：G167R	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；1.5 M ammonium sulfate, 20% glycerol, 100 mM Tris-HCl	Resolution 3.80 Å R-free 0.264
6Q9Z Crystal structure of the pathological G167R variant of calcium-free human gelsolin, Deposited 2018-12-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 28–782（755 aa）	Mutation：G167R	SO4 SULFATE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；1.5 M ammonium sulfate, 20% glycerol, 100 mM Tris-HCl	Resolution 3.80 Å R-free 0.264
6QBF Crystal structure of the pathological D187N variant of calcium-free human gelsolin. Deposited 2018-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 28–782（755 aa）	Mutation：D187N	SO4 SULFATE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；1.3 M Ammonium sulfate, 19% glycerol, 100 mM Tris HCl	Resolution 3.50 Å R-free 0.276
6QBF Crystal structure of the pathological D187N variant of calcium-free human gelsolin. Deposited 2018-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 28–782（755 aa）	Mutation：D187N	SO4 SULFATE ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；1.3 M Ammonium sulfate, 19% glycerol, 100 mM Tris HCl	Resolution 3.50 Å R-free 0.276
6QW3 Calcium-bound gelsolin domain 2 Deposited 2019-03-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 178–293（116 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；36% PEG5000 MME, 0.1M Sodium Acetate	Resolution 1.30 Å R-free 0.174
7P2B Crystal structure of human gelsolin amyloid mutant A551P Deposited 2021-07-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 28–782（755 aa）	Mutation：A551P	SO4 SULFATE ION × 4 GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；15% glycerol, 2.0 M ammonium sulfate, 0.1M tris HCl, pH8.5	Resolution 3.00 Å R-free 0.263
7P2B Crystal structure of human gelsolin amyloid mutant A551P Deposited 2021-07-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 28–782（755 aa）	Mutation：A551P	SO4 SULFATE ION × 3 GOL GLYCEROL × 3 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；15% glycerol, 2.0 M ammonium sulfate, 0.1M tris HCl, pH8.5	Resolution 3.00 Å R-free 0.263
8VIZ Structure of full-length gelsolin bound to the barbed end of F-actin Deposited 2024-01-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain G 52–782（731 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 CA CALCIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
8VKH Structure of gelsolin domains G1G3 bound to the barbed end of F-actin Deposited 2024-01-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 52–782（731 aa） Chain H 52–782（731 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 4 CA CALCIUM ION × 14 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.63 Å
9UG2 Severed and capped actin fragment by two G1G3 domains of gelsolin Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 54–401（348 aa） Chain B 54–401（348 aa）	Not recorded	CA CALCIUM ION × 8 ADP ADENOSINE-5'-DIPHOSPHATE × 4 MG MAGNESIUM ION × 5 PO4 PHOSPHATE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

60 other PDB entries and 92 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GELS_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–344； UniProt 439–782 Author chain B； PDBConstruct 1–344； UniProt 439–782 Author chain C； PDBConstruct 1–344； UniProt 439–782

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1p8x
Deposition date deposition_date	2003-05-08
Structure title title	The Calcium-Activated C-terminal half of gelsolin
Keywords keywords	calcium-binding, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	37.76 Å
Radius of gyration Rg (electron density) rg_electron	37.15 Å
Forward intensity I(0) i0	178903000.00
Molecular weight molecular_weight	106470.0 kDa
Excluded volume excluded_volume	132520 Å³
Envelope volume envelope_volume	183220 Å³
Hydration-shell volume shell_volume	42079 Å³
Envelope diameter envelope_diameter	122.6 Å
Shell Rg shell_rg	42.30 Å
Envelope Rg envelope_rg	36.33 Å
Shape Rg shape_rg	37.13 Å
Total Rg total_rg	37.55 Å
Total atoms total_atoms	7504
Residues n_residues	965
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	120.7 Å
Rg (real space) rg_real	37.69 Å
Rg uncertainty (real space) rg_real_error	0.95 Å
I(0) (real space) i0_real	1.7890e+08
I(0) uncertainty (real space) i0_real_error	2.9430e+06
Rg (reciprocal space) rg_reciprocal	37.74 Å
I(0) (reciprocal space) i0_reciprocal	178900000.0000
Solution quality estimate total_estimate	0.9058
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	48.9 Å
Skewness Skewness skewness	0.159
Kurtosis Kurtosis kurtosis	-0.652
Angular range angular_range	— – 0.2100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	13030000.0000
Real-space data points n_real_points	43
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.959; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.995; Smooth: 0.898

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Gelsolin precursor, plasma
Molecular weight formula_weight	37762.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	8544

MDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1040

▼

7. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (9 domains)

Domain ID domain_id	d1p8xa1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

Domain ID domain_id	d1p8xa2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

Domain ID domain_id	d1p8xa3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

Domain ID domain_id	d1p8xb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

Domain ID domain_id	d1p8xb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

Domain ID domain_id	d1p8xb3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

Domain ID domain_id	d1p8xc1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

Domain ID domain_id	d1p8xc2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

Domain ID domain_id	d1p8xc3
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.109 — Gelsolin-like
Superfamily Superfamily superfamily	d.109.1 — Actin depolymerizing proteins
Family Family family	d.109.1.1 — Gelsolin-like

CATH v4.4 (9 domains)

Domain ID domain_id	1p8xA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

Domain ID domain_id	1p8xA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

Domain ID domain_id	1p8xA03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

Domain ID domain_id	1p8xB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

Domain ID domain_id	1p8xB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

Domain ID domain_id	1p8xB03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

Domain ID domain_id	1p8xC01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

Domain ID domain_id	1p8xC02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

Domain ID domain_id	1p8xC03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	20 — Severin
Homologous superfamily homologous superfamily	10 — Severin

▶

8. Citations (1)

▶

Unit-cell length a length_a	84.750 Å
Unit-cell length b length_b	90.110 Å
Unit-cell length c length_c	156.940 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2050
R_work r_work	0.2050
R_free r_free	0.2450

fit	/app/data/saxs_computation/p8/1p8x/1p8x.fit
pddf	/app/data/pr_computation/p8/1p8x/1p8x.pr.out
profile	/app/data/saxs_computation/p8/1p8x/1p8x.dat