1r9s

RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX, MATCHED NUCLEOTIDE

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II largest subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–1733； UniProt 1–1733

DNA-directed RNA polymerase II 140 kDa polypeptide

OrganismNot specified

UniProt P08518

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–1224； UniProt 1–1224

DNA-directed RNA polymerase II 45 kDa polypeptide

OrganismNot specified

UniProt P16370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB3_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain C； PDBConstruct 1–318； UniProt 1–318

DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

OrganismNot specified

UniProt P20434

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB5_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215

DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

OrganismNot specified

UniProt P20435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB6_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

OrganismNot specified

UniProt P20436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 1–146

DNA-directed RNA polymerase II 14.2 kDa polypeptide

OrganismNot specified

UniProt P27999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–122； UniProt 1–122

DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

OrganismNot specified

UniProt P22139

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB10_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerase II 13.6 kDa polypeptide

OrganismNot specified

UniProt P38902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB11_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–120； UniProt 1–120

DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide

OrganismNot specified

UniProt P40422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 1 RNA 1	RNA strand × 1 DNA strand × 1 DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） MAGNESIUM ION × 2 ;URIDINE 5'-TRIPHOSPHATE ; × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPC10_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–70； UniProt 1–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1r9s
Deposition date deposition_date	2003-10-30
Structure title title	RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX, MATCHED NUCLEOTIDE
Keywords keywords	;TRANSCRIPTION, MRNA, MULTIPROTEIN COMPLEX, MOLECULAR MACHINE, DNA, TRANSCRIPTION-DNA-RNA COMPLEX, TRANSCRIPTION-DNA-RNA HYBRID complex ;; TRANSCRIPTION/DNA-RNA HYBRID
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1r9s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1r9s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1r9s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.48 Å
Rg (electron density)	46.99 Å
Total Rg	47.29 Å
Atom count	28491
Residues	3543
Excluded volume	506750 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1r9s__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	RNA strand
Molecular weight formula_weight	3264.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R
Atom count atom_count	28491

AUCGAGAGGA

Entity 2 Entity 2 polymer

Description description	DNA strand
Molecular weight formula_weight	4215.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

ACGATCCTCTCGAT

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II largest subunit
Molecular weight formula_weight	191821.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II 140 kDa polypeptide
Molecular weight formula_weight	138937.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTDRSRDF

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerase II 45 kDa polypeptide
Molecular weight formula_weight	35330.5 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide
Molecular weight formula_weight	25117.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide
Molecular weight formula_weight	17931.8 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide
Molecular weight formula_weight	16525.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II 14.2 kDa polypeptide
Molecular weight formula_weight	14308.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide
Molecular weight formula_weight	8290.7 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II 13.6 kDa polypeptide
Molecular weight formula_weight	13633.5 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide
Molecular weight formula_weight	7730.0 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR

Entity 13 Entity 13 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	;URIDINE 5'-TRIPHOSPHATE ;
Molecular weight formula_weight	484.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 15 Entity 15 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (10 domains)

Domain ID domain_id	d1r9sa_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9sb_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9sc_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9se_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9sf_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9sh_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9si_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9sj_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9sk_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1r9sl_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

▶

Unit-cell length a length_a	169.647 Å
Unit-cell length b length_b	222.338 Å
Unit-cell length c length_c	194.316 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	101.67 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	4.250 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	0.3540
R_work r_work	0.3490
R_free r_free	0.3980

RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX, MATCHED NUCLEOTIDE

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II largest subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 140 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 45 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 14.2 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 13.6 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer