1pqv

RNA polymerase II-TFIIS complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II largest subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1733； UniProt 1–1733

DNA-directed RNA polymerase II 140 kDa polypeptide

OrganismNot specified

UniProt P08518

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1224； UniProt 1–1224

DNA-directed RNA polymerase II 45 kDa polypeptide

OrganismNot specified

UniProt P16370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–318； UniProt 1–318

DNA-directed RNA polymerase II 32 kDa polypeptide

OrganismNot specified

UniProt P20433

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–221； UniProt 1–221

DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

OrganismNot specified

UniProt P20434

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215

DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

OrganismNot specified

UniProt P20435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerase II 19 kDa polypeptide

OrganismNot specified

UniProt P34087

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–171； UniProt 1–171

DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

OrganismNot specified

UniProt P20436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 1–146

DNA-directed RNA polymerase II 14.2 kDa polypeptide

OrganismNot specified

UniProt P27999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–122； UniProt 1–122

DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

OrganismNot specified

UniProt P22139

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB10_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerase II 13.6 kDa polypeptide

OrganismNot specified

UniProt P38902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB11_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–120； UniProt 1–120

DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide

OrganismNot specified

UniProt P40422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） Transcription elongation factor S-II × 1 （P07273） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPC10_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–70； UniProt 1–70

Transcription elongation factor S-II

OrganismNot specified

UniProt P07273

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	DNA-directed RNA polymerase II largest subunit × 1 （P04050） DNA-directed RNA polymerase II 140 kDa polypeptide × 1 （P08518） DNA-directed RNA polymerase II 45 kDa polypeptide × 1 （P16370） DNA-directed RNA polymerase II 32 kDa polypeptide × 1 （P20433） DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide × 1 （P20434） DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide × 1 （P20435） DNA-directed RNA polymerase II 19 kDa polypeptide × 1 （P34087） DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide × 1 （P20436） DNA-directed RNA polymerase II 14.2 kDa polypeptide × 1 （P27999） DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide × 1 （P22139） DNA-directed RNA polymerase II 13.6 kDa polypeptide × 1 （P38902） DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide × 1 （P40422） MAGNESIUM ION × 1 ZINC ION × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFS2_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain S； PDBConstruct 1–309； UniProt 1–309

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1pqv
Deposition date deposition_date	2003-06-19
Structure title title	RNA polymerase II-TFIIS complex
Keywords keywords	;TRANSCRIPTION, MRNA CLEAVAGE, PROOFREADING, BACKTRACKING, GENE EXPRESSION, MULTIPROTEIN COMPLEX, PROTEIN SOAKING, TRANSFERASE-TRANSCRIPTION COMPLEX ;; TRANSFERASE/TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1pqv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1pqv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1pqv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.94 Å
Rg (electron density)	51.57 Å
Total Rg	51.65 Å
Atom count	10
Residues	0
Excluded volume	561060 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1pqv__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase II largest subunit
Molecular weight formula_weight	191821.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4041

MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase II 140 kDa polypeptide
Molecular weight formula_weight	138937.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTDRSRDF

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II 45 kDa polypeptide
Molecular weight formula_weight	35330.5 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II 32 kDa polypeptide
Molecular weight formula_weight	24674.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide
Molecular weight formula_weight	25117.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide
Molecular weight formula_weight	17931.8 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase II 19 kDa polypeptide
Molecular weight formula_weight	19081.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide
Molecular weight formula_weight	16525.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II 14.2 kDa polypeptide
Molecular weight formula_weight	14308.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide
Molecular weight formula_weight	8290.7 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II 13.6 kDa polypeptide
Molecular weight formula_weight	13633.5 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide
Molecular weight formula_weight	7730.0 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR

Entity 13 Entity 13 polymer

Description description	Transcription elongation factor S-II
Molecular weight formula_weight	34903.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKDAINKNKRSRQAQQHHQDHAPGNAEDKTTVGESVNGVQQPASSQSDAMKQDKYVSTKPRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKFS

Entity 14 Entity 14 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 15 Entity 15 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	9

▼

6. Fold Classification (SCOP + CATH) 13 domains

SCOP 2.08 (13 domains)

Domain ID domain_id	d1pqva_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvb_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvc_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvd_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqve_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvf_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvg_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvh_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvi_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvj_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvk_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvl_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

Domain ID domain_id	d1pqvs_
Class class	i — Low resolution protein structures
Fold Fold fold	i.8 — RNA polymerase
Superfamily Superfamily superfamily	i.8.1 — RNA polymerase
Family Family family	i.8.1.1 — RNA polymerase

▶

Unit-cell length a length_a	218.900 Å
Unit-cell length b length_b	395.300 Å
Unit-cell length c length_c	281.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	3.800 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

RNA polymerase II-TFIIS complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II largest subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 140 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 45 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 32 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 19 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II 14.2 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer