7o4k

Yeast TFIIH in the contracted state within the pre-initiation complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

General transcription and DNA repair factor IIH helicase subunit XPD

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAD3_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–778； UniProt 1–778

General transcription and DNA repair factor IIH subunit TFB1

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32776

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 4–645； UniProt 1–642

General transcription and DNA repair factor IIH subunit TFB2

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q02939

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB2_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 5–517； UniProt 1–513

RNA polymerase II transcription factor B subunit 3

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q03290

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB3_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 4–324； UniProt 1–321

General transcription and DNA repair factor IIH subunit TFB4

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q12004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB4_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 4； PDBConstruct 4–341； UniProt 1–338

General transcription and DNA repair factor IIH subunit TFB5

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q3E7C1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFB5_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 5； PDBConstruct 5–76； UniProt 1–72

General transcription and DNA repair factor IIH subunit SSL1

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q04673

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSL1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 6； PDBConstruct 4–464； UniProt 1–461

General transcription and DNA repair factor IIH helicase subunit XPB

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q00578

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAD25_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 7； PDBConstruct 1–843； UniProt 1–843

DNA-directed RNA polymerase II subunit RPB1

OrganismNot specified

UniProt P04050

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain A； PDBConstruct 1–1733； UniProt 1–1733

DNA-directed RNA polymerase II subunit RPB2

OrganismNot specified

UniProt P08518

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain B； PDBConstruct 1–1224； UniProt 1–1224

DNA-directed RNA polymerase II subunit RPB4

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P20433

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB4_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain D； PDBConstruct 1–221； UniProt 1–221

DNA-directed RNA polymerases I, II, and III subunit RPABC2

OrganismNot specified

UniProt P20435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerase II subunit RPB7

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P34087

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB7_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain G； PDBConstruct 1–171； UniProt 1–171

Transcription initiation factor IIE subunit alpha

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P36100

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit beta × 1 （P36145） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2EA_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain W； PDBConstruct 1–482； UniProt 1–482

Transcription initiation factor IIE subunit beta

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P36145

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P06839） General transcription and DNA repair factor IIH subunit TFB1 × 1 （P32776） General transcription and DNA repair factor IIH subunit TFB2 × 1 （Q02939） RNA polymerase II transcription factor B subunit 3 × 1 （Q03290） General transcription and DNA repair factor IIH subunit TFB4 × 1 （Q12004） General transcription and DNA repair factor IIH subunit TFB5 × 1 （Q3E7C1） General transcription and DNA repair factor IIH subunit SSL1 × 1 （Q04673） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （Q00578） DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） Non-template DNA × 1 Template DNA × 1 Transcription initiation factor IIE subunit alpha × 1 （P36100） IRON/SULFUR CLUSTER × 1 ZINC ION × 10 BERYLLIUM TRIFLUORIDE ION × 1 MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2EB_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain X； PDBConstruct 1–328； UniProt 1–328

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7o4k
Deposition date deposition_date	2021-04-06
Structure title title	Yeast TFIIH in the contracted state within the pre-initiation complex
Keywords keywords	Pre-initiation complex, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7o4k__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7o4k__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7o4k__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	63.70 Å
Rg (electron density)	64.16 Å
Total Rg	64.12 Å
Atom count	34264
Residues	4236
Excluded volume	613290 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7o4k__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (22)

Entity 1 Entity 1 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPD
Molecular weight formula_weight	89899.0 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0
Atom count atom_count	34264

MKFYIDDLPVLFPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTVSLLSLTIAYQMHYPEHRKIIYCSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNGQAKRKLEEDPEANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTLCPYFIVRRMISLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSLDLTTDALRRATRGANALDERISEVRKVDSQKLQDEYEKLVQGLHSADILTDQEEPFVETPVLPQDLLTEAIPGNIRRAEHFVSFLKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIERKPLRFCSERLSLLVRTLEVTEVEDFTALKDIATFATLISTYEEGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVFERFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSFLPMIITKGSDQVAISSRFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIVSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRENYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADRRFSRKRSQLPKWIAQGLSDADLNLSTDMAISNTKQFLRTMAQPTDPKDQEGVSVWSYEDLIKHQNSRKDQGGFIENENKEGEQDEDEDEDIEMQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB1
Molecular weight formula_weight	73194.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

GGSMSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADIYEEKRRREESAQHTETPMSSSSVTAGTPTPHLDTPQLNNGAPLINTAKLDDSLSKEKLLTNLKLQQSLLKGNKVLMKVFQETVINAGLPPSEFWSTRIPLLRAFALSTSQKVGPYNVLSTIKPVASSENKVNVNLSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLRGEKIMQNDRGDVIIDRYLTLDQEFDRKDDDMLLHPVKKIIDLDGNIQDDPVVRGNRPDFTMQPGVDINGNSDGTVDILKGMNRLSEKMIMALKNEYSRTNLQNKSNITNDEEDEDNDERNELKIDDLNESYKTNYAIIHLKRNAHEKTTDNDAKSSADSIKNADLKVSNQQMLQQLSLVMDNLINKLDLNQVVPNNEVSNKINKRVITAIKINAKQAKHNNVNSALGSFVDNTSQANELEVKSTLPIDLLESCRMLHTTCCEFLKHFYIHFQSGEQKQASTVKKLYNHLKDCIEKLNELFQDVLNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB2
Molecular weight formula_weight	58900.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

GPGSMSDYSLKHSVTQYLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAMVFNENEVPLLDLDKWVNSNGKLQFQNAIKSMKSLHLLIPNKSSGTLMINLNPTFKISLRNALTGGEVQNSFGVVVEENVVSLDLLDEYSANKWETILHFMVGTPLAKIPSEKVLNLLKHSKLMEEVNSTGEFKITNEGFQFLLQEINSQLWTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKIDALSETQRIMLQDMRDYGLVFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNREEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSYSNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYLETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRKLKKKQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	RNA polymerase II transcription factor B subunit 3
Molecular weight formula_weight	38480.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GPHMLMDEYEENKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKGCDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNKYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIMNNLERSRTEIESFEQRQKFEKEMKLKKRLLERQIEEEERMNKEWTKKEIVNRLSTTTQDINETIEGVKNTVKLKKSSARRKLEELNRVLKNNPYFNSNVNVQNSRLKDAVPFTPFNGDREAHPRFTLKGSVYNDPFIKDLEHRKEFIASGFNTNYAYERVLTEAFMGLGCVISEEL

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB4
Molecular weight formula_weight	37778.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

SNAMDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVFLNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRNVDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIPPGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKKKVTKP

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	General transcription and DNA repair factor IIH subunit TFB5
Molecular weight formula_weight	8541.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

GPGSMARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYNPMDEEENQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	General transcription and DNA repair factor IIH subunit SSL1
Molecular weight formula_weight	52571.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

GGSMAPVVISESEEDEDRVAITRRTKRQVHFDGEGDDRVDQQQQQHSSSHRDRDKHVQRKKKKRLSNRNLQGSNGGYAWEDEIKRSWDLVKVDDEGDMASLVASIVEARKKRTAKKNITPYQRGIIRSLILTLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNYGDESFYKILLDETHLKELFNEAVTPLPVNKINKGFTLVKMGFPTRIFEDTPTFCSCHSKLVYGGYFCPNCHSKVCSLPTVCPCCDLMLILSTHLARSYHHLMPLKTFAEVPTTEKFRSEDCFSCQSRFPILKNHKNGKLLTSSRYRCEDCKQEFCVDCDVFIHEILHNCPGCESKPVIT

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPB
Molecular weight formula_weight	95461.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MTDVEGYQPKSKGKIFPDMGESFFSSDEDSPATDAEIDENYDDNRETSEGRGERDTGAMVTGLKKPRKKTKSSRHTAADSSMNQMDAKDKALLQDTNSDIPADFVPDSVSGMFRSHDFSYLRLRPDHASRPLWISPSDGRIILESFSPLAEQAQDFLVTIAEPISRPSHIHEYKITAYSLYAAVSVGLETDDIISVLDRLSKVPVAESIINFIKGATISYGKVKLVIKHNRYFVETTQADILQMLLNDSVIGPLRIDSDHQVQPPEDVLQQQLQQTAGKPATNVNPNDVEAVFSAVIGGDNEREEEDDDIDAVHSFEIANESVEVVKKRCQEIDYPVLEEYDFRNDHRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQWRQQFLQWCTLQPENCAVFTSDNKEMFQTESGLVVSTYSMVANTRNRSHDSQKVMDFLTGREWGFIILDEVHVVPAAMFRRVVSTIAAHAKLGLTATLVREDDKIGDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRGDKIIVFSDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLHGMENIPNLAYASPRERRELLQEVLLKNEEAAGIEVGDDADNSVGRGSNGHKRFKSKAVRGEGSLSGLAGGEDMAYMEYSTNKNKELKEHHPLIRKMYYKNLKK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB1
Molecular weight formula_weight	191821.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerase II subunit RPB2
Molecular weight formula_weight	138937.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTDRSRDF

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	25451.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	17931.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Entity 13 Entity 13 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19909.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAIHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 14 Entity 14 polymer

Description description	Non-template DNA
Molecular weight formula_weight	32717.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

CGAGAACAGTAGCACGCTGTGTATATAATAGCTATGGAACGTTCGATTCACCTCCGATGTGTGTTGTACATACATAAAAATATCATAGCACAACTGCGCTGTGTCA

Entity 15 Entity 15 polymer

Description description	Template DNA
Molecular weight formula_weight	32680.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

TGACACAGCGCAGTTGTGCTATGATATTTTTATGTATGTACAACACACATCGGAGGTGAATCGAACGTTCCATAGCTATTATATACACAGCGTGCTACTGTTCTCG

Entity 16 Entity 16 polymer

Description description	Transcription initiation factor IIE subunit alpha
Molecular weight formula_weight	55951.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MDRPIDDIVKNLLKFVVRGFYGGSFVLVLDAILFHSVLAEDDLKQLLSINKTELGPLIARLRSDRLISIHKQREYPPNSKSVERVYYYVKYPHAIDAIKWKVHQVVQRLKDDLDKNSEPNGYMCPICLTKYTQLEAVQLLNFDRTEFLCSLCDEPLVEDDSGKKNKEKQDKLNRLMDQIQPIIDSLKKIDDSRIEENTFEIALARLIPPQNQSHAAYTYNPKKGSTMFRPGDSAPLPNLMGTALGNDSSRRAGANSQATLHINITTASDEVAQRELQERQAEEKRKQNAVPEWHKQSTIGKTALGRLDNEEEFDPVVTASAMDSINPDNEPAQETSYQNNRTLTEQEMEERENEKTLNDYYAALAKKQAKLNKEEEEEEEEEEDEEEEEEEEMEDVMDDNDETARENALEDEFEDVTDTAGTAKTESNTSNDVKQESINDKTEDAVNATATASGPSANAKPNDGDDDDDDDDDEMDIEFEDVAAALEHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 17 Entity 17 polymer

Description description	Transcription initiation factor IIE subunit beta
Molecular weight formula_weight	37050.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSKNRDPLLANLNAFKSKVKSAPVIAPAKVGQKKTNDTVITIDGNTRKRTASERAQENTLNSAKNPVLVDIKKEAGSNSSNAISLDDDDDDEDFGSSPSKKVRPGSIAAAALQANQTDISKSHDSSKLLWATEYIQKKGKPVLVNELLDYLSMKKDDKVIELLKKLDRIEFDPKKGTFKYLSTYDVHSPSELLKLLRSQVTFKGISCKDLKDGWPQCDETINQLEEDSKILVLRTKKDKTPRYVWYNSGGNLKCIDEEFVKMWENVQLPQFAELPRKLQDLGLKPASVDPATIKRQTKRVEVKKKRQRKGKITNTHMTGILKDYSHRV

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 18 Entity 18 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 20 Entity 20 non-polymer

Description description	BERYLLIUM TRIFLUORIDE ION
Molecular weight formula_weight	66.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	7o4k001
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	7o4k101
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	7o4k301
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	40 — Herpes Virus-1
Homologous superfamily homologous superfamily	10 — Zinc/RING finger domain, C3HC4 (zinc finger)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	24671

Yeast TFIIH in the contracted state within the pre-initiation complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

General transcription and DNA repair factor IIH helicase subunit XPD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH subunit TFB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH subunit TFB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II transcription factor B subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH subunit TFB4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH subunit TFB5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH subunit SSL1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH helicase subunit XPB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer