7uif

Mediator-PIC Early (Core B)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1733； UniProt 1–1733 Author chain z； PDBConstruct 1–1733； UniProt 1–1733

DNA-directed RNA polymerase II subunit RPB2

OrganismNot specified

UniProt P08518

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1224； UniProt 1–1224

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt P16370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–318； UniProt 1–318

DNA-directed RNA polymerase II subunit RPB4

OrganismNot specified

UniProt P20433

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–221； UniProt 1–221

DNA-directed RNA polymerases I, II, and III subunit RPABC1

OrganismNot specified

UniProt P20434

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215

DNA-directed RNA polymerases I, II, and III subunit RPABC2

OrganismNot specified

UniProt P20435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt P34087

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–171； UniProt 1–171

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt P20436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB3_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 1–146

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P27999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–122； UniProt 1–122

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt P22139

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerase II subunit RPB11

OrganismNot specified

UniProt P38902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB11_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–120； UniProt 1–120

DNA-directed RNA polymerases I, II, and III subunit RPABC4

OrganismNot specified

UniProt P40422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB4_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–70； UniProt 1–70

Transcription initiation factor IIB

Saccharomyces cerevisiae S288C

UniProt P29055

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2B_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–345； UniProt 1–345

Transcription initiation factor IIF subunit alpha

OrganismNot specified

UniProt P41895

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FA_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain P； PDBConstruct 1–735； UniProt 1–735

Transcription initiation factor IIF subunit beta

OrganismNot specified

UniProt P41896

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FB_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Q； PDBConstruct 1–400； UniProt 1–400

Transcription elongation factor S-II

Saccharomyces cerevisiae S288C

UniProt P07273

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFS2_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain S； PDBConstruct 1–309； UniProt 1–309

Mediator of RNA polymerase II transcription subunit 1

OrganismNot specified

UniProt Q12321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED1_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain a； PDBConstruct 1–566； UniProt 1–566

Mediator of RNA polymerase II transcription subunit 4

OrganismNot specified

UniProt Q12343

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED4_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain d； PDBConstruct 1–284； UniProt 1–284

Mediator of RNA polymerase II transcription subunit 6

OrganismNot specified

UniProt P38782

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED6_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain f； PDBConstruct 1–295； UniProt 1–295

Mediator of RNA polymerase II transcription subunit 7

OrganismNot specified

UniProt Q08278

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED7_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain g； PDBConstruct 1–222； UniProt 1–222

Mediator of RNA polymerase II transcription subunit 8

OrganismNot specified

UniProt P38304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED8_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain h； PDBConstruct 1–223； UniProt 1–223

Mediator of RNA polymerase II transcription subunit 9

OrganismNot specified

UniProt P33308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED9_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain i； PDBConstruct 1–149； UniProt 1–149

Mediator of RNA polymerase II transcription subunit 10

OrganismNot specified

UniProt Q06213

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED10_YEAST
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain j； PDBConstruct 1–157； UniProt 1–157

Mediator of RNA polymerase II transcription subunit 11

OrganismNot specified

UniProt Q99278

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED11_YEAST
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain k； PDBConstruct 1–115； UniProt 1–115

Mediator of RNA polymerase II transcription subunit 14

OrganismNot specified

UniProt P19263

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED14_YEAST
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain n； PDBConstruct 1–1082； UniProt 1–1082

Mediator of RNA polymerase II transcription subunit 17

OrganismNot specified

UniProt P32569

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED17_YEAST
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain q； PDBConstruct 1–687； UniProt 1–687

Mediator of RNA polymerase II transcription subunit 18

OrganismNot specified

UniProt P32585

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED18_YEAST
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain r； PDBConstruct 1–307； UniProt 1–307

Mediator of RNA polymerase II transcription subunit 19

OrganismNot specified

UniProt P25046

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED19_YEAST
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain s； PDBConstruct 1–220； UniProt 1–220

Mediator of RNA polymerase II transcription subunit 20

OrganismNot specified

UniProt P34162

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED20_YEAST
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain t； PDBConstruct 1–210； UniProt 1–210

Mediator of RNA polymerase II transcription subunit 21

OrganismNot specified

UniProt P47822

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED21_YEAST
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain u； PDBConstruct 1–140； UniProt 1–140

Mediator of RNA polymerase II transcription subunit 22

OrganismNot specified

UniProt P32570

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 31 × 1 （P38633）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED22_YEAST
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain v； PDBConstruct 1–121； UniProt 1–121

Mediator of RNA polymerase II transcription subunit 31

OrganismNot specified

UniProt P38633

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	DNA-directed RNA polymerase II subunit RPB1 × 2 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerase II subunit RPB4 × 1 （P20433） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB7 × 1 （P34087） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） Transcription initiation factor IIB × 1 （P29055） Transcription initiation factor IIF subunit alpha × 1 （P41895） Transcription initiation factor IIF subunit beta × 1 （P41896） Transcription elongation factor S-II × 1 （P07273） Mediator of RNA polymerase II transcription subunit 1 × 1 （Q12321） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q12343） Mediator of RNA polymerase II transcription subunit 6 × 1 （P38782） Mediator of RNA polymerase II transcription subunit 7 × 1 （Q08278） Mediator of RNA polymerase II transcription subunit 8 × 1 （P38304） Mediator of RNA polymerase II transcription subunit 9 × 1 （P33308） Mediator of RNA polymerase II transcription subunit 10 × 1 （Q06213） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q99278） Mediator of RNA polymerase II transcription subunit 14 × 1 （P19263） Mediator of RNA polymerase II transcription subunit 17 × 1 （P32569） Mediator of RNA polymerase II transcription subunit 18 × 1 （P32585） Mediator of RNA polymerase II transcription subunit 19 × 1 （P25046） Mediator of RNA polymerase II transcription subunit 20 × 1 （P34162） Mediator of RNA polymerase II transcription subunit 21 × 1 （P47822） Mediator of RNA polymerase II transcription subunit 22 × 1 （P32570）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED31_YEAST
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain w； PDBConstruct 1–127； UniProt 1–127

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7uif
Deposition date deposition_date	2022-03-29
Structure title title	Mediator-PIC Early (Core B)
Keywords keywords	;Divergent transcription, Mediator, RNA Polymerase II, PIC, Pre-Initiation, Activation, Transcription Factor, Gal4, Gal4VP16, TRANSCRIPTION ;; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7uif__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7uif__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7uif__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	79.54 Å
Rg (electron density)	79.52 Å
Total Rg	79.39 Å
Atom count	63137
Residues	7857
Excluded volume	1128400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7uif__assembly_1__model_1`	33-meric （33）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase II subunit RPB1
Molecular weight formula_weight	191821.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,z
Atom count atom_count	63137

MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase II subunit RPB2
Molecular weight formula_weight	138937.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTDRSRDF

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	35330.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	25451.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	25117.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	17931.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19081.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16525.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14308.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	8290.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11
Molecular weight formula_weight	13633.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC4
Molecular weight formula_weight	7730.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR

Entity 13 Entity 13 polymer

Description description	Transcription initiation factor IIB
Molecular weight formula_weight	38257.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 14 Entity 14 polymer

Description description	Transcription initiation factor IIF subunit alpha
Molecular weight formula_weight	82320.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MSRRNPPGSRNGGGPTNASPFIKRDRMRRNFLRMRMGQNGSNSSSPGVPNGDNSRGSLVKKDDPEYAEEREKMLLQIGVEADAGRSNVKVKDEDPNEYNEFPLRAIPKEDLENMRTHLLKFQSKKKINPVTDFHLPVRLHRKDTRNLQFQLTRAEIVQRQKEISEYKKKAEQERSTPNSGGMNKSGTVSLNNTVKDGSQTPTVDSVTKDNTANGVNSSIPTVTGSSVPPASPTTVSAVESNGLSNGSTSAANGLDGNASTANLANGRPLVTKLEDAGPAEDPTKVGMVKYDGKEVTNEPEFEEGTMDPLADVAPDGGGRAKRGNLRRKTRQLKVLDENAKKLRFEEFYPWVMEDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTARNKYATLTIDEAEKRMDKKSGEVPRWLMKHLDNIGTTTTRYDRTRRKLKAVADQQAMDEDDRDDNSEVELDYDEEFADDEEAPIIDGNEQENKESEQRIKKEMLQANAMGLRDEEAPSENEEDELFGEKKIDEDGERIKKALQKTELAALYSSDENEINPYLSESDIENKENESPVKKEEDSDTLSKSKRSSPKKQQKKATNAHVHKEPTLRVKSIKNCVIILKGDKKILKSFPEGEWNPQTTKAVDSSNNASNTVPSPIKQEEGLNSTVAEREETPAPTITEKDIIEAIGDGKVNIKEFGKFIRRKYPGAENKKLMFAIVKKLCRKVGNDHMELKKE

Entity 15 Entity 15 polymer

Description description	Transcription initiation factor IIF subunit beta
Molecular weight formula_weight	46684.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSSGSAGAPALSNNSTNSVAKEKSGNISGDEYLSQEEEVFDGNDIENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINKDGSKITLLLNENDNDSIPHEYDLELTKKVVENEYVFTEQNLKKYQQRKKELEADPEKQRQAYLKKQEREEELKKKQQQQKRRNNRKKFNHRVMTDRDGRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQRRNIVKLNNKERITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYAFKYTLRPEYKKLKEEERKATLGELADEQTGSAGDNAQGDAEADLEDEIEMEDVV

Entity 16 Entity 16 polymer

Description description	Transcription elongation factor S-II
Molecular weight formula_weight	34903.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKDAINKNKRSRQAQQHHQDHAPGNAEDKTTVGESVNGVQQPASSQSDAMKQDKYVSTKPRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKFS

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 17 Entity 17 polymer

Description description	Mediator of RNA polymerase II transcription subunit 1
Molecular weight formula_weight	64315.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MVEGDSYVETLDSMIELFKDYKPGSITLENITRLCQTLGLESFTEELSNELSRLSTASKIIVIDVDYNKKQDRIQDVKLVLASNFDNFDYFNQRDGEHEKSNILLNSLTKYPDLKAFHNNLKFLYLLDAYSHIESDSTSHNNGSSDKSLDSSNASFNNQGKLDLFKYFTELSHYIRQCFQDNCCDFKVRTNLNDKFGIYILTQGINGKEVPLAKIYLEENKSDSQYRFYEYIYSQETKSWINESAENFSNGISLVMEIVANAKESNYTDLIWFPEDFISPELIIDKVTCSSNSSSSPPIIDLFSNNNYNSRIQLMNDFTTKLINIKKFDISNDNLDLISEILKWVQWSRIVLQNVFKLVSTPSSNSNSSELEPDYQAPFSTSTKDKNSSTSNTEPIPRSNRHGSVVEASRRRRSSTNKSKRPSITEAMMLKEEGLQQFNLHEILSEPAIEEENGDSIKEHSTTMDGANDLGFTASVSNQENAGTDIVMEDHGVLQGTSQNYGTATADDADIEMKDVSSKPSKPESSVLQLIVSEDHIILDTISECNLYDDVKCWSKFIEKFQDIVS

Entity 18 Entity 18 polymer

Description description	Mediator of RNA polymerase II transcription subunit 4
Molecular weight formula_weight	32244.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPPSQSEEQKGQMAKKEGTPKTDSFIFDGTAKEVGDEADNTKDKEKEENNDDALDLDLDLFDPDDF

Entity 19 Entity 19 polymer

Description description	Mediator of RNA polymerase II transcription subunit 6
Molecular weight formula_weight	32844.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI

Entity 20 Entity 20 polymer

Description description	Mediator of RNA polymerase II transcription subunit 7
Molecular weight formula_weight	25616.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MSNDPGNEVSSLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITCALDYLIPPPMPKNQQYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELRKLLKSLLLNYLELIGVLSINPDMYERKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIEQVCKQVHDKLTSIQDTLRTGSQSPPSSSQ

Entity 21 Entity 21 polymer

Description description	Mediator of RNA polymerase II transcription subunit 8
Molecular weight formula_weight	25297.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN

Entity 22 Entity 22 polymer

Description description	Mediator of RNA polymerase II transcription subunit 9
Molecular weight formula_weight	17400.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTSSNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPSEWQDIIHQREQELQIKRDVLDDLYRKLQR

Entity 23 Entity 23 polymer

Description description	Mediator of RNA polymerase II transcription subunit 10
Molecular weight formula_weight	17927.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MNGNSTNNEQLQQELATTQDQVASIIESFVELGVSIYDFPGTPEATKGMITNLQRNVDRLYKLNVRSNDPQSSLSKVDIPLEVVQYIEDGRNPDIYTREFVEAIRRSNQYQRGKMHGLKQLRDSLADKIVDEFPELKEPVEDIIKRTSPIDNVSNTH

Entity 24 Entity 24 polymer

Description description	Mediator of RNA polymerase II transcription subunit 11
Molecular weight formula_weight	13324.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK

Entity 25 Entity 25 polymer

Description description	Mediator of RNA polymerase II transcription subunit 14
Molecular weight formula_weight	123500.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MTTTIGSPQMLANEERLSNEMHALKNRSEQNGQEQQGPVKNTQLHGPSATDPETTATQKESLEMVPKDTSAATMTSAPPPALPHVEINQVSLALVIRNLTVFTMKELAQYMKTNVHTQANEPNSAKKIRFLQLIIFLRTQFLKLYVLVKWTRTIKQNNFHVLIDLLNWFRTTNMNVNNCIWALKSSLNSMTNAKLPNVDLVTALEVLSLGRPNLPTHNFKLSGVSNSMDMVDGMAKVPIGLILQRLKDLNLTVSIKIALMNIPKPLNSYHIKNGRIYFTVPNEFEIQLSTVNRQSPLFFVDLKLLFNTEAEQTVSAVTEATSTNGDSENNEENSSSNGNNLPLNKPRLEKLINEILLKSNDPLLSLYNFLHKYVLTLQLYMVHREFLKLANGGKFSKSNLIHNYDSKKSTITVRYWLNGKMDSKGKITIGIQRTTESLILKWDNQSASRAKNMPVIYNNIVSNIEGILDEIMFNHARIIRSELLARDIFQEDEENSDVLLFQLPTTCVSMAPIQLKIDLLSGQFYFRNPTPLLSNYASKINRAEGPEELARILQQLKLDKIIHVLTTMFENTGWSCSRIIKIDKPIRTQVNTGGESVVKKEDNKYAIAGNSTTNSDVSLLLQRDLFIRLPHWPLNWYLILSIISSKTSCVVEKRIGKIVSQRGKWNLKYLDNSNVMTVKLESITYQKIMILQRTILNRIINHMLIDSLNQLEIRNKICSSEMINEQKLPQYIIQGSNTNDNISIITLELESFLEGSKALNSILESSMFLRIDYSNSQIRLYAKFKRNTMMIQCQIDKLYIHFVQEEPLAFYLEESFTNLGIIVQYLTKFRQKLMQLVVLTDVVERLHKNFESENFKIIALQPNEISFKYLSNNDEDDKDCTIKISTNDDSIKNLTVQLSPSNPQHIIQPFLDNSKMDYHFIFSYLQFTSSLFKALKVILNERGGKFHESGSQYSTMVNIGLHNLNEYQIVYYNPQAGTKITICIELKTVLHNGRDKIQFHIHFADVAHITTKSPAYPMMHQVRNQVFMLDTKRLGTPESVKPANASHAIRLGNGVACDPSEIEPILMEIHNILKVDSNSSSS

Entity 26 Entity 26 polymer

Description description	Mediator of RNA polymerase II transcription subunit 17
Molecular weight formula_weight	78582.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MTTEDPDSNHLSSETGIKLALDPNLITLALSSNPNSSLHSPTSDEPVPESAGKADTSIRLEGDELENKTKKDNDKNLKFLKNKDSLVSNPHEIYGSMPLEQLIPIILRQRGPGFKFVDLNEKELQNEIKQLGSDSSDGHNSEKKDTDGADENVQIGEDFMEVDYEDKDNPVDSRNETDHKTNENGETDDNIETVMTQEQFVKRRRDMLEHINLAMNESSLALEFVSLLLSSVKESTGMSSMSPFLRKVVKPSSLNSDKIPYVAPTKKEYIELDILNKGWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNKDVIFKIRDRTSGQKLLAIKYGYEDSGSTYKHDRGIANIRNNIESQNLDLIPHSSSVFKGTDFVHSVKKFLRVRIFTKIESEDDYILSGESVMDRDSESEEAETKDIRKQIQLLKKIIFEKELMYQIKKECALLISYGVSIENENKVIIELPNEKFEIELLSLDDDSIVNHEQDLPKINDKRANLMLVMLRLLLVVIFKKTLRSRISSPHGLINLNVDDDILIIRPILGKVRFANYKLLLKKIIKDYVLDIVPGSSITETEVEREQPQENKNIDDENITKLNKEIRAFDKLLNIPRRELKINLPLTEHKSPNLSLMLESPNYCNALIHIKFSAGTEANAVSFDTTFSDFKEVEDFLHFIVAEYIQQKKV

Entity 27 Entity 27 polymer

Description description	Mediator of RNA polymerase II transcription subunit 18
Molecular weight formula_weight	34316.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI

Entity 28 Entity 28 polymer

Description description	Mediator of RNA polymerase II transcription subunit 19
Molecular weight formula_weight	24885.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MASRVDETTVPSYYYYVDPETTYTYQQPNPLQDLISVYGLDDISRQVARTNLDGTKAVKLRKSYKNQIADLSGKFSTIPTRENGKGGQIAHILFQNNPDMMIQPPQQGQNMSEQQWREQLRNRDIALFQPPNFDWDLCSSVLSQFERSYPSEFANQNQGGAQAPFDIDDLAFDLDGTGKSQSGSNSGNNSKKRKNKSSGSSMATPTHSDSHEDMKRRRLE

Entity 29 Entity 29 polymer

Description description	Mediator of RNA polymerase II transcription subunit 20
Molecular weight formula_weight	22918.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL

Entity 30 Entity 30 polymer

Description description	Mediator of RNA polymerase II transcription subunit 21
Molecular weight formula_weight	16093.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MTDRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVNEPQMSDKHATVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLRHVDSLIEDFVDGIANSKKST

Entity 31 Entity 31 polymer

Description description	Mediator of RNA polymerase II transcription subunit 22
Molecular weight formula_weight	13875.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT

Entity 32 Entity 32 polymer

Description description	Mediator of RNA polymerase II transcription subunit 31
Molecular weight formula_weight	14747.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MSSTNGNAPATPSSDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELPKIIQLQGPQWMNEMVERWAN

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	91293

Mediator-PIC Early (Core B)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer