SAXSdb — 2hzm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase II mediator complex subunit 20

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	RNA polymerase II mediator complex subunit 18 × 1 （P32585） PHOSPHATE ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	RNA polymerase II mediator complex subunit 18 × 1 （P32585） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	RNA polymerase II mediator complex subunit 18 × 1 （P32585） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	RNA polymerase II mediator complex subunit 18 × 1 （P32585） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED20_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–212； UniProt 1–210 Author chain C； PDBConstruct 3–212； UniProt 1–210 Author chain E； PDBConstruct 3–212； UniProt 1–210 Author chain G； PDBConstruct 3–212； UniProt 1–210

RNA polymerase II mediator complex subunit 18

Saccharomyces cerevisiae

UniProt P32585

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	RNA polymerase II mediator complex subunit 20 × 1 （P34162） PHOSPHATE ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	RNA polymerase II mediator complex subunit 20 × 1 （P34162） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	RNA polymerase II mediator complex subunit 20 × 1 （P34162） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	RNA polymerase II mediator complex subunit 20 × 1 （P34162） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED18_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–306； UniProt 2–307 Author chain D； PDBConstruct 1–306； UniProt 2–307 Author chain F； PDBConstruct 1–306； UniProt 2–307 Author chain H； PDBConstruct 1–306； UniProt 2–307

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2hzm
Deposition date deposition_date	2006-08-09
Structure title title	Structure of the Mediator head subcomplex Med18/20
Keywords keywords	beta barrel, channel, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2hzm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2hzm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2hzm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.20 Å
Rg (electron density)	25.55 Å
Total Rg	26.26 Å
Atom count	3364
Residues	432
Excluded volume	60322 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2hzm__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2hzm__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2hzm__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2hzm__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	RNA polymerase II mediator complex subunit 20
Molecular weight formula_weight	23076.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	13587

ASMGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	RNA polymerase II mediator complex subunit 18
Molecular weight formula_weight	35497.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

VQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETVLMNLKKELQGYIELSVPDRQSMDSRVAHGNILIAAALEHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	229

▼

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	2hzmA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	180 —

Domain ID domain_id	2hzmA02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	140 — q64v53_bacfr protein fold
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2hzmB00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	320 — Hypothetical Protein Pfu-838710-001
Homologous superfamily homologous superfamily	10 — Hypothetical Protein Pfu-838710-001

Domain ID domain_id	2hzmC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	180 —

Domain ID domain_id	2hzmC02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	140 — q64v53_bacfr protein fold
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2hzmD00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	320 — Hypothetical Protein Pfu-838710-001
Homologous superfamily homologous superfamily	10 — Hypothetical Protein Pfu-838710-001

Domain ID domain_id	2hzmE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	180 —

Domain ID domain_id	2hzmE02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	140 — q64v53_bacfr protein fold
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2hzmF00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	320 — Hypothetical Protein Pfu-838710-001
Homologous superfamily homologous superfamily	10 — Hypothetical Protein Pfu-838710-001

Domain ID domain_id	2hzmG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	180 —

Domain ID domain_id	2hzmG02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	140 — q64v53_bacfr protein fold
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2hzmH00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	320 — Hypothetical Protein Pfu-838710-001
Homologous superfamily homologous superfamily	10 — Hypothetical Protein Pfu-838710-001

▶

Unit-cell length a length_a	72.903 Å
Unit-cell length b length_b	129.352 Å
Unit-cell length c length_c	241.725 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2280
R_work r_work	0.2280
R_free r_free	0.2640

Structure of the Mediator head subcomplex Med18/20

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase II mediator complex subunit 20

State in the Current Structure

Other States of the Same Protein in the Database

RNA polymerase II mediator complex subunit 18

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hzm__assembly_1__model_1

2hzm__assembly_1__model_1 | I(q)

2hzm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)

Structure of the Mediator head subcomplex Med18/20

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase II mediator complex subunit 20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II mediator complex subunit 18

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hzm__assembly_1__model_1

2hzm__assembly_1__model_1 | I(q)

2hzm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)