6rql

RNA Polymerase I Closed Conformation 2 (CC2)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase I-specific transcription initiation factor RRN7

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN7_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Q； PDBConstruct 1–514； UniProt 1–514

RNA polymerase I-specific transcription initiation factor RRN6

Saccharomyces cerevisiae

UniProt P32786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN6_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain S； PDBConstruct 1–894； UniProt 1–894

RNA polymerase I-specific transcription initiation factor RRN11

Saccharomyces cerevisiae

UniProt Q04712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN11_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain R； PDBConstruct 1–507； UniProt 1–507

DNA-directed RNA polymerase I subunit RPA49

Saccharomyces cerevisiae

UniProt Q01080

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA49_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–415； UniProt 1–415

DNA-directed RNA polymerase I subunit RPA190

Saccharomyces cerevisiae

UniProt P10964

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–1664； UniProt 1–1664

DNA-directed RNA polymerase I subunit RPA135

Saccharomyces cerevisiae

UniProt P22138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA2_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–1203； UniProt 1–1203

DNA-directed RNA polymerases I and III subunit RPAC1

Saccharomyces cerevisiae

UniProt P07703

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAC1_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 1–335； UniProt 1–335

DNA-directed RNA polymerase I subunit RPA14

Saccharomyces cerevisiae

UniProt P50106

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA14_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–137； UniProt 1–137

DNA-directed RNA polymerases I, II, and III subunit RPABC1

Saccharomyces cerevisiae

UniProt P20434

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB1_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215

DNA-directed RNA polymerases I, II, and III subunit RPABC2

Saccharomyces cerevisiae

UniProt P20435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerase I subunit RPA43

Saccharomyces cerevisiae

UniProt P46669

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA43_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain G； PDBConstruct 1–326； UniProt 1–326

DNA-directed RNA polymerases I, II, and III subunit RPABC3

Saccharomyces cerevisiae

UniProt P20436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB3_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 1–146

DNA-directed RNA polymerase I subunit RPA12

Saccharomyces cerevisiae

UniProt P32529

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA12_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain I； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerases I, II, and III subunit RPABC5

Saccharomyces cerevisiae

UniProt P22139

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerases I and III subunit RPAC2

Saccharomyces cerevisiae

UniProt P28000

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAC2_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain K； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerases I, II, and III subunit RPABC4

Saccharomyces cerevisiae

UniProt P40422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB4_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain L； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerase I subunit RPA34

Saccharomyces cerevisiae

UniProt P47006

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） RNA polymerase I-specific transcription initiation factor RRN3 × 1 （P36070）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA34_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain N； PDBConstruct 1–233； UniProt 1–233

RNA polymerase I-specific transcription initiation factor RRN3

Saccharomyces cerevisiae

UniProt P36070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Template strand × 1 Nontemplate strand × 1 RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） DNA-directed RNA polymerase I subunit RPA49 × 1 （Q01080） DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） DNA-directed RNA polymerase I subunit RPA34 × 1 （P47006）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN3_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain O； PDBConstruct 1–627； UniProt 1–627

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6rql
Deposition date deposition_date	2019-05-16
Structure title title	RNA Polymerase I Closed Conformation 2 (CC2)
Keywords keywords	RNA Polymerase I, Pre-initiation complex, PIC, Closed Complex, CC, Core Factor, CF, Rrn3, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6rql__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6rql__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6rql__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.49 Å
Rg (electron density)	65.20 Å
Total Rg	65.24 Å
Atom count	51626
Residues	6330
Excluded volume	915270 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6rql__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	Template strand
Molecular weight formula_weight	21216.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T
Atom count atom_count	51626

GTCTTCAACTGCTTTCGCATGAAGTACCTCCCAACTACTTTTCCTCACACTTGTACTCCATGACTAAACC

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	synthetic construct

Entity 2 Entity 2 polymer

Description description	Nontemplate strand
Molecular weight formula_weight	21942.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	U

GGTTTAGTCATGGAGTACAAGTGTGAGGAAAAGTAGTTGGGAGGTACTTCATGCGAAAGCAGTTGAAGAC

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	synthetic construct

Entity 3 Entity 3 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN7
Molecular weight formula_weight	60435.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSTFIRGPICGTDNCPSRLWRIIDGRRTCQYGHVMEGDVEFNDDEDDLNGLGAGVITRRLNLTTNATGSFQSSQLTNSQLLQQQQRQSHKKFKKLIGHEAKLLFLKSFQFILKRQIRWLITEMRFPKEFEHVAKIIWLKILKTINDQPQEELKLQLHMTSTISILYLASTHLSLPVYTCDYIKWICTAKMPYFQASEILPKSWRIQLPNYYVSILEGSISPFNGQLYNKIALTCGMIHFKEFFNSEISCQGLLLKLVMQCALPPEFYFYTKQVIEFEETDIRNLTLWERTDERHTGRVSNHAELRVLSYFMLTINWMLSFDRDRQYPLKWILSLTESLTQRTTTSESIGRNIVKVVYPDKPTSSDYFQWSEEETLEFLKWMEKQFLPTQTKSLHNENGSMEMTIDQKIARRKLYKIFPLDREANHDGEFNDSTHQLTFIEDLQERYAKQTPFFESNKIRDSLNYQEANPPARKEAIGRLLTHIASQLLVDFAISKEQLKDCISRIKNACLHRMN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN6
Molecular weight formula_weight	102163.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MSEGQIPSSDVLGSQLGVGVQGASLYCPQENYTTKKQEKPQWLRPVDDTLAEDALDLHIVVKSLLCDTAIRYISDDKVLQESDADDDLITSDIDEDTDNQGDTSIVVNPVIPVVPKDVHFFKKVDVGNDSMFGVNCDTPVSFQDYIPSDLLRNLDDTLQESTNSSRPMQDAFFWDPTVANRLDSQYIQTASDLRNYRDGTEIIAYASGKTGSVLNIAVLTRQNTLHLNRHNNVTSIELHSPIKSIKIPGASESIGRRSNLVGIITENSFQIFRIESVHSRSCDVMVSSSEPLYFVEIDDLQVVDFAFNPWDLQQFAIIDIKGNWSIGRIPKNFNNNNKRKLQLIDNLHGTIFDPEELSSWKRIEWFSHFQKILVFDRSKMIEIDFMNNWQTEVVQAKAWSNIRDYKRIDDKNGILLTSREIIIVGASESNDPVRRISWKHDLDPDDTTLRITVQKVKKPDHILLVAFVYSMRHKRIYMHVFSHRKANLFQSLGCSTVLEIPGGTPTGIETILTLDHIDDESRREEDADENFELVVDFLVKLRNSSEVYYYALSNTQNSEPNKQETPIIVDHPEWASLFNNADEREKESIGALVSQIKLKERERISRVQNLIEHENSHDEDKYLQDLGYRLSIATNELLESWQKTKDESILSGSLSHSKLKNLLENSDSFASIPEFSSLLDQFFQYYQDQDVTFIGFEKLLHLFLHEDVPGLDIFYNKLLQCWVLVSPQAELLTKEIVKDIIWSLARLEKPSLFEPIQNEISRSLSGPYQDIISSWDMDDINEEDESNEFNFDSQFSAPFNGRPPFNLNSQSQIPTIKSSQSSGLARRKRILKTQSQKATPLSQSTQNLSVLPDSMTPAFTLMQPPSSQISFVNDSQPRNSQKAKKKKKRIRGFG

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN11
Molecular weight formula_weight	59334.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNAEFLDTQLMDLSPEDNGLDEMHYSDEDSSE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase I subunit RPA49
Molecular weight formula_weight	46721.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSVKRSVSEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGLFNPEKKSIQLYKAPVLVSKVVSKSSKNLRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSDKLTDSAIDIVDSVRTASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESIIPKKELQFIRVSSILKEADKEKKLELFPYQNNSKYVAKKLDSLTQPSQMTKLQLLYYLSLLLGVYENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKPGQFGRSKDRSYFIDPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKPSKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVPFKLPEMTRRGRGPRR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase I subunit RPA190
Molecular weight formula_weight	186677.0 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDNLGHPVSGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLLQYGLIDESYKLDEITLGSLNSSMYTDDEAIEDNEDEMDGEGSKQSKDISSTLLNELKSKRSEYVDMAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSRGKCDNCGMFSPKFRKDGFTKIFETALNEKQITNNRVKGFIRQDMIKKQKQAKKLDGSNEASANDEESFDVGRNPTTRPKTGSTYILSTEVKNILDTVFRKEQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLNDDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSNTAGGNAARSYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAVPRLQTDVANSSSNSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGIDSDKESDSDSEDEDVDMNEQINKSIVEANNNMNKVQRDRQSAIISHHRFITKYNFDDESGKWCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVLAKVPNAA

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerase I subunit RPA135
Molecular weight formula_weight	135910.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNVEPK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerases I and III subunit RPAC1
Molecular weight formula_weight	37732.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNKAEYLKNCPITQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerase I subunit RPA14
Molecular weight formula_weight	14599.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MMKGSRRTGNNTATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENIIDSTTMNTISGNAADADAAAVANTSLNIDTNLSSSISQLKRIQRDFKGLPPAQDFSAAPIQVSTTEKKETSIGVSATGGKKTTFADE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	25117.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	17931.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 13 Entity 13 polymer

Description description	DNA-directed RNA polymerase I subunit RPA43
Molecular weight formula_weight	36264.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSQVKRANENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVEEDADVINTDENNGNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLISDADEEGNGYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSESNDGESSDSD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 14 Entity 14 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16525.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 15 Entity 15 polymer

Description description	DNA-directed RNA polymerase I subunit RPA12
Molecular weight formula_weight	13676.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 16 Entity 16 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	8290.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 17 Entity 17 polymer

Description description	DNA-directed RNA polymerases I and III subunit RPAC2
Molecular weight formula_weight	16167.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 18 Entity 18 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC4
Molecular weight formula_weight	7730.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 19 Entity 19 polymer

Description description	DNA-directed RNA polymerase I subunit RPA34
Molecular weight formula_weight	26933.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSKLSKDYVSDSDSDDEVISNEFSIPDGFKKCKHLKNFPLNGDNKKKAKQQQVWLIKFPSNVDISKLKSLPVDFESSTTMTIDKHDYKIMDDTDIESSLTQDNLSNMTLLVPSESKESLKIASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDVPKVEGLKLEHFATGYDAEDFHVAEEVKENKKEPKKRSHHDDEEESSEKKKKKKEKREKREKKDKKDKKKKHRD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 20 Entity 20 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN3
Molecular weight formula_weight	72458.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MMAFENTSKRPPQDFVAPIDQKKRKVQFSDSTGLVTLQPEEIKDEVFSAAMYSRFVKSALDDLDKNDSTQIGIIANQVALPSKNPERINDKNLNILLDILSSNINRIESSRGTFLIQSIINFEKWWELPPHTLSKYIYFIKILCSSIPKWWQDVSMILVSCFILPIKQTVCHHDMLKYFLRMIPSSMGFIDTYLAKFFPNKNDTRRKLVNYTSNLLKLRGYCSELGFQIWSLLIEKIISIDVELQNELDELDDDVDDDDLEEVDLEDDDDLDDDSGDDDDENCGNSNEELRSGAADGSQSDSEDMDIIEGMDGTEEYNVELTQGIKELSTKLDSILTLVSTHVEEQVTPESLESGEGVGVFNTLTTLFKTHVLPTYYTRSIQYIMFHVSQQQLELMDSFLVTLIDISFAVNEAAEKKIKSLQYLGSYIARAKKLSRTQIIFVASYLTSWLNRYVIEREEEVDQRGGMERFKHFYAAFQALCYIFCFRHNIFRDTDGNWECELDKFFQRMVISKFNPLKFCNENVMLMFARIAQQESVAYCFSIIENNNNERLRGIIGKADSDKKENSAQANTTSSSWSLATRQQFIDLQSYFPYDPLFLKNYKILMKEYYIEWSEASGEYESDGSDD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 15 domains

CATH v4.4 (15 domains)

Domain ID domain_id	6rqlB04
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	6rqlB05
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1070 — Hypothetical Protein Ta0175; Chain: A, domain 2
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6rqlB06
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	270 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; Domain 6
Homologous superfamily homologous superfamily	10 — DNA-directed RNA polymerase, subunit 2, domain 6

Domain ID domain_id	6rqlB07
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	150 — RNA polymerase II, Rpb2 subunit, wall domain

Domain ID domain_id	6rqlB08
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1800 — DCoH-like
Homologous superfamily homologous superfamily	10 — RNA polymerase alpha subunit dimerisation domain

Domain ID domain_id	6rqlC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	6rqlC02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	120 — RNA Polymerase Alpha Subunit; Chain A, domain 2
Homologous superfamily homologous superfamily	12 — DNA-directed RNA polymerase, insert domain

Domain ID domain_id	6rqlE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1340 — Dna-directed Rna Polymerases I, Ii, And Iii 27 Kd Polypeptide; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — RNA polymerase, Rpb5, N-terminal domain

Domain ID domain_id	6rqlE02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	20 — RPB5-like RNA polymerase subunit

Domain ID domain_id	6rqlF00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	10 — RNA polymerase subunit, RPB6/omega

Domain ID domain_id	6rqlG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	120 — RNA polymerase Rpb7-like, N-terminal domain

Domain ID domain_id	6rqlH00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	6rqlJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	6rqlK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	6rqlL00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	28 — Rubrerythrin, domain 2
Homologous superfamily homologous superfamily	30 — RNA polymerase ii, chain L

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	24482

RNA Polymerase I Closed Conformation 2 (CC2)

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase I-specific transcription initiation factor RRN7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase I-specific transcription initiation factor RRN6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase I-specific transcription initiation factor RRN11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA49

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA190

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA135

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I and III subunit RPAC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer