SAXSdb — 5o7x

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase I-specific transcription initiation factor RRN6

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 1–894	Not recorded	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain D； UniProt 1–894	Not recorded	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
3	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain G； UniProt 1–894	Not recorded	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
4	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain J； UniProt 1–894	Not recorded	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
5	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain M； UniProt 1–894	Not recorded	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
6	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain P； UniProt 1–894	Not recorded	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5O7X	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5N5Y Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation III) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain P 1–894（894 aa）	Not recorded	ZN ZINC ION × 8 SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N5Z Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation II) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain P 1–894（894 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N60 Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation I) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain P 1–894（894 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N61 RNA polymerase I initially transcribing complex Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 21-meric	Chain P 1–894（894 aa）	Not recorded	ZN ZINC ION × 7 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5OA1 RNA polymerase I pre-initiation complex Deposited 2017-06-20	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 32 PDB declaration: 34-meric	Chain V 1–894（894 aa）	Not recorded	ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5W5Y RNA polymerase I Initial Transcribing Complex Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain O 1–894（894 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5W64 RNA Polymerase I Initial Transcribing Complex State 1 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain O 1–894（894 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
5W65 RNA polymerase I Initial Transcribing Complex State 2 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain O 1–894（894 aa）	Not recorded	ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
5W66 RNA polymerase I Initial Transcribing Complex State 3 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain O 1–894（894 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6RQH RNA Polymerase I Closed Conformation 1 (CC1) Deposited 2019-05-15	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain S 1–894（894 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6RQL RNA Polymerase I Closed Conformation 2 (CC2) Deposited 2019-05-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain S 1–894（894 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6RRD RNA Polymerase I Pre-initiation complex DNA opening intermediate 1 Deposited 2019-05-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain S 1–894（894 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6RUI RNA Polymerase I Pre-initiation complex DNA opening intermediate 2 Deposited 2019-05-28	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain S 1–894（894 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
6RUO RNA Polymerase I Open Complex conformation 1 Deposited 2019-05-28	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain S 1–894（894 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6RWE RNA Polymerase I Open Complex conformation 2 Deposited 2019-06-04	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain S 1–894（894 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
6TPS early intermediate RNA Polymerase I Pre-initiation complex - eiPIC Deposited 2019-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 22-meric	Chain P 169–779（611 aa）	Not recorded	ZN ZINC ION × 7 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RRN6_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–894； UniProt 1–894 Author chain D； PDBConstruct 1–894； UniProt 1–894 Author chain G； PDBConstruct 1–894； UniProt 1–894 Author chain J； PDBConstruct 1–894； UniProt 1–894 Author chain M； PDBConstruct 1–894； UniProt 1–894 Author chain P； PDBConstruct 1–894； UniProt 1–894

RNA polymerase I-specific transcription initiation factor RRN7

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P40992

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 1–514	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain E； UniProt 1–514	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
3	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain H； UniProt 1–514	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
4	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain K； UniProt 1–514	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
5	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain N； UniProt 1–514	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
6	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain Q； UniProt 1–514	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5O7X	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5N5Y Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation III) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 8 SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N5Z Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation II) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N60 Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation I) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N61 RNA polymerase I initially transcribing complex Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 21-meric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 7 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5OA1 RNA polymerase I pre-initiation complex Deposited 2017-06-20	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 32 PDB declaration: 34-meric	Chain U 1–514（514 aa）	Not recorded	ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5W5Y RNA polymerase I Initial Transcribing Complex Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain P 1–514（514 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5W64 RNA Polymerase I Initial Transcribing Complex State 1 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain P 1–514（514 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
5W65 RNA polymerase I Initial Transcribing Complex State 2 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain P 1–514（514 aa）	Not recorded	ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
5W66 RNA polymerase I Initial Transcribing Complex State 3 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain P 1–514（514 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6RQH RNA Polymerase I Closed Conformation 1 (CC1) Deposited 2019-05-15	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain Q 1–514（514 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6RQL RNA Polymerase I Closed Conformation 2 (CC2) Deposited 2019-05-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain Q 1–514（514 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6RRD RNA Polymerase I Pre-initiation complex DNA opening intermediate 1 Deposited 2019-05-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6RUI RNA Polymerase I Pre-initiation complex DNA opening intermediate 2 Deposited 2019-05-28	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
6RUO RNA Polymerase I Open Complex conformation 1 Deposited 2019-05-28	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6RWE RNA Polymerase I Open Complex conformation 2 Deposited 2019-06-04	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
6TPS early intermediate RNA Polymerase I Pre-initiation complex - eiPIC Deposited 2019-12-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 22-meric	Chain Q 1–514（514 aa）	Not recorded	ZN ZINC ION × 7 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RRN7_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–514； UniProt 1–514 Author chain E； PDBConstruct 1–514； UniProt 1–514 Author chain H； PDBConstruct 1–514； UniProt 1–514 Author chain K； PDBConstruct 1–514； UniProt 1–514 Author chain N； PDBConstruct 1–514； UniProt 1–514 Author chain Q； PDBConstruct 1–514； UniProt 1–514

RNA polymerase I-specific transcription initiation factor RRN11

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q04712

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 1–507	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain F； UniProt 1–507	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
3	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain I； UniProt 1–507	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
4	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain L； UniProt 1–507	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
5	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain O； UniProt 1–507	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283
6	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain R； UniProt 1–507	Not recorded	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；12% PEG 4000 , 500mM Ammonium sulfate, 100mM MES pH=6.0, 1mM DTT	Resolution 3.20 Å R-free 0.283

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5O7X	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5N5Y Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation III) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 8 SO4 SULFATE ION × 5 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N5Z Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation II) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N60 Cryo-EM structure of RNA polymerase I in complex with Rrn3 and Core Factor (Orientation I) Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
5N61 RNA polymerase I initially transcribing complex Deposited 2017-02-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: 21-meric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 7 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5OA1 RNA polymerase I pre-initiation complex Deposited 2017-06-20	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 32 PDB declaration: 34-meric	Chain W 1–507（507 aa）	Not recorded	ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5W5Y RNA polymerase I Initial Transcribing Complex Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain Q 1–507（507 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5W64 RNA Polymerase I Initial Transcribing Complex State 1 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain Q 1–507（507 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
5W65 RNA polymerase I Initial Transcribing Complex State 2 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain Q 1–507（507 aa）	Not recorded	ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
5W66 RNA polymerase I Initial Transcribing Complex State 3 Deposited 2017-06-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: eicosameric	Chain Q 1–507（507 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6RQH RNA Polymerase I Closed Conformation 1 (CC1) Deposited 2019-05-15	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain R 1–507（507 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6RQL RNA Polymerase I Closed Conformation 2 (CC2) Deposited 2019-05-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain R 1–507（507 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6RRD RNA Polymerase I Pre-initiation complex DNA opening intermediate 1 Deposited 2019-05-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6RUI RNA Polymerase I Pre-initiation complex DNA opening intermediate 2 Deposited 2019-05-28	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
6RUO RNA Polymerase I Open Complex conformation 1 Deposited 2019-05-28	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6RWE RNA Polymerase I Open Complex conformation 2 Deposited 2019-06-04	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
6TPS early intermediate RNA Polymerase I Pre-initiation complex - eiPIC Deposited 2019-12-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 22-meric	Chain R 1–507（507 aa）	Not recorded	ZN ZINC ION × 7 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RRN11_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–507； UniProt 1–507 Author chain F； PDBConstruct 1–507； UniProt 1–507 Author chain I； PDBConstruct 1–507； UniProt 1–507 Author chain L； PDBConstruct 1–507； UniProt 1–507 Author chain O； PDBConstruct 1–507； UniProt 1–507 Author chain R； PDBConstruct 1–507； UniProt 1–507

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5o7x
Deposition date deposition_date	2017-06-09
Structure title title	CRYSTAL STRUCTURE OF S. CEREVISIAE CORE FACTOR AT 3.2A RESOLUTION
Keywords keywords	TRANSCRIPTION, RNA POLYMERASE I INITIATION, CORE FACTOR; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	123.30 Å
Forward intensity I(0) i0	10426000000.00
Molecular weight molecular_weight	899530.0 kDa
Excluded volume excluded_volume	1136500 Å³
Envelope volume envelope_volume	2295600 Å³
Hydration-shell volume shell_volume	168660 Å³
Envelope diameter envelope_diameter	399.1 Å
Shell Rg shell_rg	99.27 Å
Envelope Rg envelope_rg	117.80 Å
Shape Rg shape_rg	123.30 Å
Total Rg total_rg	123.20 Å
Total atoms total_atoms	63438
Residues n_residues	7668
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	332.2 Å
Rg (real space) rg_real	114.80 Å
Rg uncertainty (real space) rg_real_error	2.05 Å
I(0) (real space) i0_real	9.9890e+09
I(0) uncertainty (real space) i0_real_error	2.6670e+08
Rg (reciprocal space) rg_reciprocal	102.00 Å
I(0) (reciprocal space) i0_reciprocal	9759000000.0000
Solution quality estimate total_estimate	0.8906
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	83.1 Å
Skewness Skewness skewness	0.339
Kurtosis Kurtosis kurtosis	-0.916
Angular range angular_range	— – 0.0600 Å⁻¹
Current regularization parameter α current_alpha	1.0600
Highest regularization parameter α highest_alpha	180900000.0000
Real-space data points n_real_points	13
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.001; Oscil: 0.903; Stabil: 0.965; Sysdev: 1.000; Positv: 1.000; Valcen: 0.970; Smooth: 0.004

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN6
Molecular weight formula_weight	102163.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P
Atom count atom_count	63438

MSEGQIPSSDVLGSQLGVGVQGASLYCPQENYTTKKQEKPQWLRPVDDTLAEDALDLHIVVKSLLCDTAIRYISDDKVLQESDADDDLITSDIDEDTDNQGDTSIVVNPVIPVVPKDVHFFKKVDVGNDSMFGVNCDTPVSFQDYIPSDLLRNLDDTLQESTNSSRPMQDAFFWDPTVANRLDSQYIQTASDLRNYRDGTEIIAYASGKTGSVLNIAVLTRQNTLHLNRHNNVTSIELHSPIKSIKIPGASESIGRRSNLVGIITENSFQIFRIESVHSRSCDVMVSSSEPLYFVEIDDLQVVDFAFNPWDLQQFAIIDIKGNWSIGRIPKNFNNNNKRKLQLIDNLHGTIFDPEELSSWKRIEWFSHFQKILVFDRSKMIEIDFMNNWQTEVVQAKAWSNIRDYKRIDDKNGILLTSREIIIVGASESNDPVRRISWKHDLDPDDTTLRITVQKVKKPDHILLVAFVYSMRHKRIYMHVFSHRKANLFQSLGCSTVLEIPGGTPTGIETILTLDHIDDESRREEDADENFELVVDFLVKLRNSSEVYYYALSNTQNSEPNKQETPIIVDHPEWASLFNNADEREKESIGALVSQIKLKERERISRVQNLIEHENSHDEDKYLQDLGYRLSIATNELLESWQKTKDESILSGSLSHSKLKNLLENSDSFASIPEFSSLLDQFFQYYQDQDVTFIGFEKLLHLFLHEDVPGLDIFYNKLLQCWVLVSPQAELLTKEIVKDIIWSLARLEKPSLFEPIQNEISRSLSGPYQDIISSWDMDDINEEDESNEFNFDSQFSAPFNGRPPFNLNSQSQIPTIKSSQSSGLARRKRILKTQSQKATPLSQSTQNLSVLPDSMTPAFTLMQPPSSQISFVNDSQPRNSQKAKKKKKRIRGFG

来源 Source

来源生物 organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
NCBI Class编号 ncbi_taxonomy_id	559292
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN7
Molecular weight formula_weight	60435.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K,N,Q

MSTFIRGPICGTDNCPSRLWRIIDGRRTCQYGHVMEGDVEFNDDEDDLNGLGAGVITRRLNLTTNATGSFQSSQLTNSQLLQQQQRQSHKKFKKLIGHEAKLLFLKSFQFILKRQIRWLITEMRFPKEFEHVAKIIWLKILKTINDQPQEELKLQLHMTSTISILYLASTHLSLPVYTCDYIKWICTAKMPYFQASEILPKSWRIQLPNYYVSILEGSISPFNGQLYNKIALTCGMIHFKEFFNSEISCQGLLLKLVMQCALPPEFYFYTKQVIEFEETDIRNLTLWERTDERHTGRVSNHAELRVLSYFMLTINWMLSFDRDRQYPLKWILSLTESLTQRTTTSESIGRNIVKVVYPDKPTSSDYFQWSEEETLEFLKWMEKQFLPTQTKSLHNENGSMEMTIDQKIARRKLYKIFPLDREANHDGEFNDSTHQLTFIEDLQERYAKQTPFFESNKIRDSLNYQEANPPARKEAIGRLLTHIASQLLVDFAISKEQLKDCISRIKNACLHRMN

来源 Source

来源生物 organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
NCBI Class编号 ncbi_taxonomy_id	559292
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN11
Molecular weight formula_weight	59334.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L,O,R

MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNAEFLDTQLMDLSPEDNGLDEMHYSDEDSSE

来源 Source

来源生物 organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
NCBI Class编号 ncbi_taxonomy_id	559292
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	man
Copy count entity_count	30

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;BAKER'S YEAST ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	man
Copy count entity_count	6

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;BAKER'S YEAST ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	Escherichia coli BL21(DE3)

▶

8. Citations (1)

▶

Unit-cell length a length_a	109.070 Å
Unit-cell length b length_b	109.140 Å
Unit-cell length c length_c	385.640 Å
Unit-cell angle α angle_alpha	90.02 °
Unit-cell angle β angle_beta	90.01 °
Unit-cell angle γ angle_gamma	59.98 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	54.570 Å
R factor r_factor	0.2553
R_work r_work	0.2544
R_free r_free	0.2828

fit	/app/data/saxs_computation/o7/5o7x/5o7x.fit
pddf	/app/data/pr_computation/o7/5o7x/5o7x.pr.out
profile	/app/data/saxs_computation/o7/5o7x/5o7x.dat

CRYSTAL STRUCTURE OF S. CEREVISIAE CORE FACTOR AT 3.2A RESOLUTION

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase I-specific transcription initiation factor RRN6

State in the Current Structure

Other States of the Same Protein in the Database

RNA polymerase I-specific transcription initiation factor RRN7

State in the Current Structure

Other States of the Same Protein in the Database

RNA polymerase I-specific transcription initiation factor RRN11

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

来源 Source

Entity 5 Entity 5 non-polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)