SAXSdb — 5o7x

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase I-specific transcription initiation factor RRN6

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN6_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–894； UniProt 1–894 Author chain D； PDBConstruct 1–894； UniProt 1–894 Author chain G； PDBConstruct 1–894； UniProt 1–894 Author chain J； PDBConstruct 1–894； UniProt 1–894 Author chain M； PDBConstruct 1–894； UniProt 1–894 Author chain P； PDBConstruct 1–894； UniProt 1–894

RNA polymerase I-specific transcription initiation factor RRN7

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P40992

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN11 × 1 （Q04712） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN7_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–514； UniProt 1–514 Author chain E； PDBConstruct 1–514； UniProt 1–514 Author chain H； PDBConstruct 1–514； UniProt 1–514 Author chain K； PDBConstruct 1–514； UniProt 1–514 Author chain N； PDBConstruct 1–514； UniProt 1–514 Author chain Q； PDBConstruct 1–514； UniProt 1–514

RNA polymerase I-specific transcription initiation factor RRN11

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q04712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	RNA polymerase I-specific transcription initiation factor RRN6 × 1 （P32786） RNA polymerase I-specific transcription initiation factor RRN7 × 1 （P40992） SULFATE ION × 5 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN11_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–507； UniProt 1–507 Author chain F； PDBConstruct 1–507； UniProt 1–507 Author chain I； PDBConstruct 1–507； UniProt 1–507 Author chain L； PDBConstruct 1–507； UniProt 1–507 Author chain O； PDBConstruct 1–507； UniProt 1–507 Author chain R； PDBConstruct 1–507； UniProt 1–507

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5o7x
Deposition date deposition_date	2017-06-09
Structure title title	CRYSTAL STRUCTURE OF S. CEREVISIAE CORE FACTOR AT 3.2A RESOLUTION
Keywords keywords	TRANSCRIPTION, RNA POLYMERASE I INITIATION, CORE FACTOR; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5o7x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5o7x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5o7x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.38 Å
Rg (electron density)	36.73 Å
Total Rg	37.15 Å
Atom count	10573
Residues	1278
Excluded volume	189410 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5o7x__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5o7x__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5o7x__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5o7x__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`5o7x__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`5o7x__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN6
Molecular weight formula_weight	102163.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P
Atom count atom_count	63438

MSEGQIPSSDVLGSQLGVGVQGASLYCPQENYTTKKQEKPQWLRPVDDTLAEDALDLHIVVKSLLCDTAIRYISDDKVLQESDADDDLITSDIDEDTDNQGDTSIVVNPVIPVVPKDVHFFKKVDVGNDSMFGVNCDTPVSFQDYIPSDLLRNLDDTLQESTNSSRPMQDAFFWDPTVANRLDSQYIQTASDLRNYRDGTEIIAYASGKTGSVLNIAVLTRQNTLHLNRHNNVTSIELHSPIKSIKIPGASESIGRRSNLVGIITENSFQIFRIESVHSRSCDVMVSSSEPLYFVEIDDLQVVDFAFNPWDLQQFAIIDIKGNWSIGRIPKNFNNNNKRKLQLIDNLHGTIFDPEELSSWKRIEWFSHFQKILVFDRSKMIEIDFMNNWQTEVVQAKAWSNIRDYKRIDDKNGILLTSREIIIVGASESNDPVRRISWKHDLDPDDTTLRITVQKVKKPDHILLVAFVYSMRHKRIYMHVFSHRKANLFQSLGCSTVLEIPGGTPTGIETILTLDHIDDESRREEDADENFELVVDFLVKLRNSSEVYYYALSNTQNSEPNKQETPIIVDHPEWASLFNNADEREKESIGALVSQIKLKERERISRVQNLIEHENSHDEDKYLQDLGYRLSIATNELLESWQKTKDESILSGSLSHSKLKNLLENSDSFASIPEFSSLLDQFFQYYQDQDVTFIGFEKLLHLFLHEDVPGLDIFYNKLLQCWVLVSPQAELLTKEIVKDIIWSLARLEKPSLFEPIQNEISRSLSGPYQDIISSWDMDDINEEDESNEFNFDSQFSAPFNGRPPFNLNSQSQIPTIKSSQSSGLARRKRILKTQSQKATPLSQSTQNLSVLPDSMTPAFTLMQPPSSQISFVNDSQPRNSQKAKKKKKRIRGFG

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN7
Molecular weight formula_weight	60435.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K,N,Q

MSTFIRGPICGTDNCPSRLWRIIDGRRTCQYGHVMEGDVEFNDDEDDLNGLGAGVITRRLNLTTNATGSFQSSQLTNSQLLQQQQRQSHKKFKKLIGHEAKLLFLKSFQFILKRQIRWLITEMRFPKEFEHVAKIIWLKILKTINDQPQEELKLQLHMTSTISILYLASTHLSLPVYTCDYIKWICTAKMPYFQASEILPKSWRIQLPNYYVSILEGSISPFNGQLYNKIALTCGMIHFKEFFNSEISCQGLLLKLVMQCALPPEFYFYTKQVIEFEETDIRNLTLWERTDERHTGRVSNHAELRVLSYFMLTINWMLSFDRDRQYPLKWILSLTESLTQRTTTSESIGRNIVKVVYPDKPTSSDYFQWSEEETLEFLKWMEKQFLPTQTKSLHNENGSMEMTIDQKIARRKLYKIFPLDREANHDGEFNDSTHQLTFIEDLQERYAKQTPFFESNKIRDSLNYQEANPPARKEAIGRLLTHIASQLLVDFAISKEQLKDCISRIKNACLHRMN

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN11
Molecular weight formula_weight	59334.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L,O,R

MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNAEFLDTQLMDLSPEDNGLDEMHYSDEDSSE

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	man
Copy count entity_count	30

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;BAKER'S YEAST ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	man
Copy count entity_count	6

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;BAKER'S YEAST ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	109.070 Å
Unit-cell length b length_b	109.140 Å
Unit-cell length c length_c	385.640 Å
Unit-cell angle α angle_alpha	90.02 °
Unit-cell angle β angle_beta	90.01 °
Unit-cell angle γ angle_gamma	59.98 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	54.570 Å
R factor r_factor	0.2553
R_work r_work	0.2544
R_free r_free	0.2828

CRYSTAL STRUCTURE OF S. CEREVISIAE CORE FACTOR AT 3.2A RESOLUTION

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase I-specific transcription initiation factor RRN6

State in the Current Structure

Other States of the Same Protein in the Database

RNA polymerase I-specific transcription initiation factor RRN7

State in the Current Structure

Other States of the Same Protein in the Database

RNA polymerase I-specific transcription initiation factor RRN11

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5o7x__assembly_1__model_1

5o7x__assembly_1__model_1 | I(q)

5o7x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Source Source

Entity 5 Entity 5 non-polymer

Source Source

7. Citations (1)

CRYSTAL STRUCTURE OF S. CEREVISIAE CORE FACTOR AT 3.2A RESOLUTION

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA polymerase I-specific transcription initiation factor RRN6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase I-specific transcription initiation factor RRN7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase I-specific transcription initiation factor RRN11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5o7x__assembly_1__model_1

5o7x__assembly_1__model_1 | I(q)

5o7x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Source Source

Entity 5 Entity 5 non-polymer

Source Source

7. Citations (1)