6hls

Yeast apo RNA polymerase I*

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase I subunit RPA190

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1664； UniProt 1–1664

DNA-directed RNA polymerase I subunit RPA135

OrganismNot specified

UniProt P22138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1203； UniProt 1–1203

DNA-directed RNA polymerases I and III subunit RPAC1

OrganismNot specified

UniProt P07703

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAC1_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–335； UniProt 1–335

DNA-directed RNA polymerase I subunit RPA14

OrganismNot specified

UniProt P50106

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA14_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–137； UniProt 1–137

DNA-directed RNA polymerases I, II, and III subunit RPABC1

OrganismNot specified

UniProt P20434

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215

DNA-directed RNA polymerases I, II, and III subunit RPABC2

OrganismNot specified

UniProt P20435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerase I subunit RPA43

OrganismNot specified

UniProt P46669

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA43_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–326； UniProt 1–326

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt P20436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB3_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 1–146

DNA-directed RNA polymerase I subunit RPA12

OrganismNot specified

UniProt P32529

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA12_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt P22139

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerases I and III subunit RPAC2

OrganismNot specified

UniProt P28000

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAC2_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerases I, II, and III subunit RPABC4

OrganismNot specified

UniProt P40422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA-directed RNA polymerase I subunit RPA190 × 1 （P10964） DNA-directed RNA polymerase I subunit RPA135 × 1 （P22138） DNA-directed RNA polymerases I and III subunit RPAC1 × 1 （P07703） DNA-directed RNA polymerase I subunit RPA14 × 1 （P50106） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase I subunit RPA43 × 1 （P46669） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase I subunit RPA12 × 1 （P32529） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I and III subunit RPAC2 × 1 （P28000） ZINC ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB4_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–70； UniProt 1–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6hls
Deposition date deposition_date	2018-09-11
Structure title title	Yeast apo RNA polymerase I*
Keywords keywords	transcription, polymerase, nucleotide, elongation; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6hls__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6hls__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6hls__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.22 Å
Rg (electron density)	50.65 Å
Total Rg	50.91 Å
Atom count	30954
Residues	3896
Excluded volume	551920 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6hls__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase I subunit RPA190
Molecular weight formula_weight	186677.0 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	30954

MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDNLGHPVSGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLLQYGLIDESYKLDEITLGSLNSSMYTDDEAIEDNEDEMDGEGSKQSKDISSTLLNELKSKRSEYVDMAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSRGKCDNCGMFSPKFRKDGFTKIFETALNEKQITNNRVKGFIRQDMIKKQKQAKKLDGSNEASANDEESFDVGRNPTTRPKTGSTYILSTEVKNILDTVFRKEQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLNDDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSNTAGGNAARSYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAVPRLQTDVANSSSNSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGIDSDKESDSDSEDEDVDMNEQINKSIVEANNNMNKVQRDRQSAIISHHRFITKYNFDDESGKWCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVLAKVPNAA

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase I subunit RPA135
Molecular weight formula_weight	135910.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNVEPK

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerases I and III subunit RPAC1
Molecular weight formula_weight	37732.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNKAEYLKNCPITQ

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase I subunit RPA14
Molecular weight formula_weight	14599.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MMKGSRRTGNNTATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENIIDSTTMNTISGNAADADAAAVANTSLNIDTNLSSSISQLKRIQRDFKGLPPAQDFSAAPIQVSTTEKKETSIGVSATGGKKTTFADE

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	25117.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	17931.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase I subunit RPA43
Molecular weight formula_weight	36264.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSQVKRANENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVEEDADVINTDENNGNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLISDADEEGNGYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSESNDGESSDSD

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16525.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase I subunit RPA12
Molecular weight formula_weight	13676.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	8290.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerases I and III subunit RPAC2
Molecular weight formula_weight	16167.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC4
Molecular weight formula_weight	7730.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	7

▼

6. Fold Classification (SCOP + CATH) 15 domains

CATH v4.4 (15 domains)

Domain ID domain_id	6hlsB04
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	6hlsB05
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1070 — Hypothetical Protein Ta0175; Chain: A, domain 2
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6hlsB06
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	270 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; Domain 6
Homologous superfamily homologous superfamily	10 — DNA-directed RNA polymerase, subunit 2, domain 6

Domain ID domain_id	6hlsB07
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	150 — RNA polymerase II, Rpb2 subunit, wall domain

Domain ID domain_id	6hlsB08
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1800 — DCoH-like
Homologous superfamily homologous superfamily	10 — RNA polymerase alpha subunit dimerisation domain

Domain ID domain_id	6hlsC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	6hlsC02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	120 — RNA Polymerase Alpha Subunit; Chain A, domain 2
Homologous superfamily homologous superfamily	12 — DNA-directed RNA polymerase, insert domain

Domain ID domain_id	6hlsD01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3390 —

Domain ID domain_id	6hlsE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1340 — Dna-directed Rna Polymerases I, Ii, And Iii 27 Kd Polypeptide; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — RNA polymerase, Rpb5, N-terminal domain

Domain ID domain_id	6hlsE02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	20 — RPB5-like RNA polymerase subunit

Domain ID domain_id	6hlsF00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	10 — RNA polymerase subunit, RPB6/omega

Domain ID domain_id	6hlsH00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	6hlsJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	6hlsK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	6hlsL00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	28 — Rubrerythrin, domain 2
Homologous superfamily homologous superfamily	30 — RNA polymerase ii, chain L

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.21 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	73660

Yeast apo RNA polymerase I*

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase I subunit RPA190

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA135

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I and III subunit RPAC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA43

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer