9n5d

RNA polymerase II elongation complex with 8-oxoG at +1 site, CMP added

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

Saccharomyces cerevisiae S288C

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–1733； UniProt 1–1733

DNA-directed RNA polymerase II subunit RPB2

Saccharomyces cerevisiae S288C

UniProt P08518

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–1224； UniProt 1–1224

DNA-directed RNA polymerase II subunit RPB3

Saccharomyces cerevisiae S288C

UniProt P16370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB3_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–318； UniProt 1–318

DNA-directed RNA polymerases I, II, and III subunit RPABC1

Saccharomyces cerevisiae S288C

UniProt P20434

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain E； PDBConstruct 1–215； UniProt 1–215

DNA-directed RNA polymerases I, II, and III subunit RPABC2

Saccharomyces cerevisiae S288C

UniProt P20435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

DNA-directed RNA polymerases I, II, and III subunit RPABC3

Saccharomyces cerevisiae S288C

UniProt P20436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB3_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 1–146

DNA-directed RNA polymerase II subunit RPB9

Saccharomyces cerevisiae S288C

UniProt P27999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 1–122； UniProt 1–122

DNA-directed RNA polymerases I, II, and III subunit RPABC5

Saccharomyces cerevisiae S288C

UniProt P22139

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 1–70

DNA-directed RNA polymerase II subunit RPB11

Saccharomyces cerevisiae S288C

UniProt P38902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 1 （P40422） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB11_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain K； PDBConstruct 1–120； UniProt 1–120

DNA-directed RNA polymerases I, II, and III subunit RPABC4

Saccharomyces cerevisiae S288C

UniProt P40422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	RNA × 1 Template strand DNA × 1 Non-template strand DNA × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P04050） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08518） DNA-directed RNA polymerase II subunit RPB3 × 1 （P16370） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （P20434） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （P20435） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （P20436） DNA-directed RNA polymerase II subunit RPB9 × 1 （P27999） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （P22139） DNA-directed RNA polymerase II subunit RPB11 × 1 （P38902） ZINC ION × 8 MAGNESIUM ION × 1 PYROPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB4_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L； PDBConstruct 1–70； UniProt 1–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9n5d
Deposition date deposition_date	2025-02-04
Last revision last_revision	2025-08-13
Structure title title	RNA polymerase II elongation complex with 8-oxoG at +1 site, CMP added
Keywords keywords	RNA polymerase II, oxidative damage, transcription, in vitro transcription, 8-oxoguanine; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9n5d__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9n5d__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9n5d__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.50 Å
Rg (electron density)	47.03 Å
Total Rg	47.31 Å
Atom count	29066
Residues	3595
Excluded volume	514720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9n5d__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	RNA
Molecular weight formula_weight	3240.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R
Atom count atom_count	29066

AUCGAGAGGC

Entity 2 Entity 2 polymer

Description description	Template strand DNA
Molecular weight formula_weight	8755.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

CCTTCTCTCTCTCGCTGAGCCTCTCGATG

Entity 3 Entity 3 polymer

Description description	Non-template strand DNA
Molecular weight formula_weight	5663.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

TCAGCGAGAGAGAGAAGG

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit RPB1
Molecular weight formula_weight	191821.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerase II subunit RPB2
Molecular weight formula_weight	138937.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTDRSRDF

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	35330.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	25117.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	17931.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16525.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14308.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	8290.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11
Molecular weight formula_weight	13633.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 13 Entity 13 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC4
Molecular weight formula_weight	7730.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 14 Entity 14 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 15 Entity 15 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	PYROPHOSPHATE
Molecular weight formula_weight	178.0 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	165.899 Å
Unit-cell length b length_b	222.270 Å
Unit-cell length c length_c	193.145 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.27 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	3.350 Å
Low-resolution limit resolution_low	49.310 Å
R factor r_factor	0.2652
R_work r_work	0.2645
R_free r_free	0.3004

RNA polymerase II elongation complex with 8-oxoG at +1 site, CMP added

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer