1rue

RHINOVIRUS 14 SITE DIRECTED MUTANT N1219A COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035

Method: X-RAY DIFFRACTION D_max: 96.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RHINOVIRUS 14

Human rhinovirus 14

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 240 PDB declaration: 240-MERIC（240） Consistent with protein copy count	Chain 1； UniProt 567–855 Chain 2； UniProt 69–330 Chain 3； UniProt 331–566 Chain 4； UniProt 1–68	Mutation：N(1)219A	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.90 Å
2	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain 1； UniProt 567–855 Chain 2； UniProt 69–330 Chain 3； UniProt 331–566 Chain 4； UniProt 1–68	Mutation：N(1)219A	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.90 Å
3	Protein homooligomer Homooligomer Protein × 20 PDB declaration: eicosameric（20） Consistent with protein copy count	Chain 1； UniProt 567–855 Chain 2； UniProt 69–330 Chain 3； UniProt 331–566 Chain 4； UniProt 1–68	Mutation：N(1)219A	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.90 Å
4	Protein homooligomer Homooligomer Protein × 24 PDB declaration: 24-meric（24） Consistent with protein copy count	Chain 1； UniProt 567–855 Chain 2； UniProt 69–330 Chain 3； UniProt 331–566 Chain 4； UniProt 1–68	Mutation：N(1)219A	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.90 Å
5	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain 1； UniProt 567–855 Chain 2； UniProt 69–330 Chain 3； UniProt 331–566 Chain 4； UniProt 1–68	Mutation：N(1)219A	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.90 Å
6	Protein homooligomer Homooligomer Protein × 80 PDB declaration: 80-meric（80） Consistent with protein copy count	Chain 1； UniProt 567–855 Chain 2； UniProt 69–330 Chain 3； UniProt 331–566 Chain 4； UniProt 1–68	Mutation：N(1)219A	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.90 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1RUE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1D3I CRYO-EM STRUCTURE OF HUMAN RHINOVIRUS 14 (HRV14) COMPLEXED WITH A TWO-DOMAIN FRAGMENT OF ITS CELLULAR RECEPTOR, INTERCELLULAR ADHESION MOLECULE-1 (D1D2-ICAM-1). IMPLICATIONS FOR VIRUS-RECEPTOR INTERACTIONS. ALPHA CARBONS ONLY Deposited 1999-09-29	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions HRV14 WAS INCUBATED WITH D1D2-ICAM-1 FOR 30 MINUTES AT 4 DEGREES CELSIUS (277 KELVIN) USING AN EIGHT-FOLD EXCESS OF D1D2-ICAM-1 FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER.	Resolution 26.00 Å
1D3I CRYO-EM STRUCTURE OF HUMAN RHINOVIRUS 14 (HRV14) COMPLEXED WITH A TWO-DOMAIN FRAGMENT OF ITS CELLULAR RECEPTOR, INTERCELLULAR ADHESION MOLECULE-1 (D1D2-ICAM-1). IMPLICATIONS FOR VIRUS-RECEPTOR INTERACTIONS. ALPHA CARBONS ONLY Deposited 1999-09-29	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions HRV14 WAS INCUBATED WITH D1D2-ICAM-1 FOR 30 MINUTES AT 4 DEGREES CELSIUS (277 KELVIN) USING AN EIGHT-FOLD EXCESS OF D1D2-ICAM-1 FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER.	Resolution 26.00 Å
1D3I CRYO-EM STRUCTURE OF HUMAN RHINOVIRUS 14 (HRV14) COMPLEXED WITH A TWO-DOMAIN FRAGMENT OF ITS CELLULAR RECEPTOR, INTERCELLULAR ADHESION MOLECULE-1 (D1D2-ICAM-1). IMPLICATIONS FOR VIRUS-RECEPTOR INTERACTIONS. ALPHA CARBONS ONLY Deposited 1999-09-29	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions HRV14 WAS INCUBATED WITH D1D2-ICAM-1 FOR 30 MINUTES AT 4 DEGREES CELSIUS (277 KELVIN) USING AN EIGHT-FOLD EXCESS OF D1D2-ICAM-1 FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER.	Resolution 26.00 Å
1D3I CRYO-EM STRUCTURE OF HUMAN RHINOVIRUS 14 (HRV14) COMPLEXED WITH A TWO-DOMAIN FRAGMENT OF ITS CELLULAR RECEPTOR, INTERCELLULAR ADHESION MOLECULE-1 (D1D2-ICAM-1). IMPLICATIONS FOR VIRUS-RECEPTOR INTERACTIONS. ALPHA CARBONS ONLY Deposited 1999-09-29	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions HRV14 WAS INCUBATED WITH D1D2-ICAM-1 FOR 30 MINUTES AT 4 DEGREES CELSIUS (277 KELVIN) USING AN EIGHT-FOLD EXCESS OF D1D2-ICAM-1 FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER.	Resolution 26.00 Å
1D3I CRYO-EM STRUCTURE OF HUMAN RHINOVIRUS 14 (HRV14) COMPLEXED WITH A TWO-DOMAIN FRAGMENT OF ITS CELLULAR RECEPTOR, INTERCELLULAR ADHESION MOLECULE-1 (D1D2-ICAM-1). IMPLICATIONS FOR VIRUS-RECEPTOR INTERACTIONS. ALPHA CARBONS ONLY Deposited 1999-09-29	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions HRV14 WAS INCUBATED WITH D1D2-ICAM-1 FOR 30 MINUTES AT 4 DEGREES CELSIUS (277 KELVIN) USING AN EIGHT-FOLD EXCESS OF D1D2-ICAM-1 FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER.	Resolution 26.00 Å
1HRI STRUCTURE DETERMINATION OF ANTIVIRAL COMPOUND SCH 38057 COMPLEXED WITH HUMAN RHINOVIRUS 14 Deposited 1992-10-01	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	S57 1-[6-(2-CHLORO-4-METHYXYPHENOXY)-HEXYL]-IMIDAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1HRI STRUCTURE DETERMINATION OF ANTIVIRAL COMPOUND SCH 38057 COMPLEXED WITH HUMAN RHINOVIRUS 14 Deposited 1992-10-01	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	S57 1-[6-(2-CHLORO-4-METHYXYPHENOXY)-HEXYL]-IMIDAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1HRI STRUCTURE DETERMINATION OF ANTIVIRAL COMPOUND SCH 38057 COMPLEXED WITH HUMAN RHINOVIRUS 14 Deposited 1992-10-01	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	S57 1-[6-(2-CHLORO-4-METHYXYPHENOXY)-HEXYL]-IMIDAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1HRI STRUCTURE DETERMINATION OF ANTIVIRAL COMPOUND SCH 38057 COMPLEXED WITH HUMAN RHINOVIRUS 14 Deposited 1992-10-01	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	S57 1-[6-(2-CHLORO-4-METHYXYPHENOXY)-HEXYL]-IMIDAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1HRI STRUCTURE DETERMINATION OF ANTIVIRAL COMPOUND SCH 38057 COMPLEXED WITH HUMAN RHINOVIRUS 14 Deposited 1992-10-01	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	S57 1-[6-(2-CHLORO-4-METHYXYPHENOXY)-HEXYL]-IMIDAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1HRI STRUCTURE DETERMINATION OF ANTIVIRAL COMPOUND SCH 38057 COMPLEXED WITH HUMAN RHINOVIRUS 14 Deposited 1992-10-01	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	S57 1-[6-(2-CHLORO-4-METHYXYPHENOXY)-HEXYL]-IMIDAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1HRV HRV14/SDZ 35-682 COMPLEX Deposited 1995-03-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	SDZ 1-[2-HYDROXY-3-(4-CYCLOHEXYL-PHENOXY)-PROPYL]-4-(2-PYRIDYL)-PIPERAZINE × 60	X-RAY DIFFRACTION X-ray crystallization conditions 3-4 CRYSTALS SOAKED IN 200 MICROLITER DROPS OF SDZ 35-682 (5 MICROGRAM/ML).	Resolution 3.00 Å
1HRV HRV14/SDZ 35-682 COMPLEX Deposited 1995-03-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	SDZ 1-[2-HYDROXY-3-(4-CYCLOHEXYL-PHENOXY)-PROPYL]-4-(2-PYRIDYL)-PIPERAZINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions 3-4 CRYSTALS SOAKED IN 200 MICROLITER DROPS OF SDZ 35-682 (5 MICROGRAM/ML).	Resolution 3.00 Å
1HRV HRV14/SDZ 35-682 COMPLEX Deposited 1995-03-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	SDZ 1-[2-HYDROXY-3-(4-CYCLOHEXYL-PHENOXY)-PROPYL]-4-(2-PYRIDYL)-PIPERAZINE × 5	X-RAY DIFFRACTION X-ray crystallization conditions 3-4 CRYSTALS SOAKED IN 200 MICROLITER DROPS OF SDZ 35-682 (5 MICROGRAM/ML).	Resolution 3.00 Å
1HRV HRV14/SDZ 35-682 COMPLEX Deposited 1995-03-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	SDZ 1-[2-HYDROXY-3-(4-CYCLOHEXYL-PHENOXY)-PROPYL]-4-(2-PYRIDYL)-PIPERAZINE × 6	X-RAY DIFFRACTION X-ray crystallization conditions 3-4 CRYSTALS SOAKED IN 200 MICROLITER DROPS OF SDZ 35-682 (5 MICROGRAM/ML).	Resolution 3.00 Å
1HRV HRV14/SDZ 35-682 COMPLEX Deposited 1995-03-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	SDZ 1-[2-HYDROXY-3-(4-CYCLOHEXYL-PHENOXY)-PROPYL]-4-(2-PYRIDYL)-PIPERAZINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions 3-4 CRYSTALS SOAKED IN 200 MICROLITER DROPS OF SDZ 35-682 (5 MICROGRAM/ML).	Resolution 3.00 Å
1HRV HRV14/SDZ 35-682 COMPLEX Deposited 1995-03-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	SDZ 1-[2-HYDROXY-3-(4-CYCLOHEXYL-PHENOXY)-PROPYL]-4-(2-PYRIDYL)-PIPERAZINE × 20	X-RAY DIFFRACTION X-ray crystallization conditions 3-4 CRYSTALS SOAKED IN 200 MICROLITER DROPS OF SDZ 35-682 (5 MICROGRAM/ML).	Resolution 3.00 Å
1K5M Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3 Loop Chimeric Virus MN-III-2 Deposited 2001-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 240 PDB declaration: 240-MERIC	Chain A 568–856（289 aa） Chain B 70–228（159 aa） Chain B 229–331（103 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M ammonium formate and 0.15 M sodium HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å
1K5M Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3 Loop Chimeric Virus MN-III-2 Deposited 2001-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 568–856（289 aa） Chain B 70–228（159 aa） Chain B 229–331（103 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M ammonium formate and 0.15 M sodium HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å
1K5M Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3 Loop Chimeric Virus MN-III-2 Deposited 2001-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 20 PDB declaration: eicosameric	Chain A 568–856（289 aa） Chain B 70–228（159 aa） Chain B 229–331（103 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M ammonium formate and 0.15 M sodium HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å
1K5M Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3 Loop Chimeric Virus MN-III-2 Deposited 2001-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 568–856（289 aa） Chain B 70–228（159 aa） Chain B 229–331（103 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M ammonium formate and 0.15 M sodium HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å
1K5M Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3 Loop Chimeric Virus MN-III-2 Deposited 2001-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 568–856（289 aa） Chain B 70–228（159 aa） Chain B 229–331（103 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M ammonium formate and 0.15 M sodium HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å
1K5M Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3 Loop Chimeric Virus MN-III-2 Deposited 2001-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Insufficient information Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 568–856（289 aa） Chain B 70–228（159 aa） Chain B 229–331（103 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 15	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M ammonium formate and 0.15 M sodium HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å
1NA1 The structure of HRV14 when complexed with Pleconaril Deposited 2002-11-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；HEPES, NaCl, CaCl2, PEG8K, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.30 Å R-free 0.228
1NA1 The structure of HRV14 when complexed with Pleconaril Deposited 2002-11-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；HEPES, NaCl, CaCl2, PEG8K, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.30 Å R-free 0.228
1NA1 The structure of HRV14 when complexed with Pleconaril Deposited 2002-11-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；HEPES, NaCl, CaCl2, PEG8K, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.30 Å R-free 0.228
1NA1 The structure of HRV14 when complexed with Pleconaril Deposited 2002-11-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；HEPES, NaCl, CaCl2, PEG8K, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.30 Å R-free 0.228
1NA1 The structure of HRV14 when complexed with Pleconaril Deposited 2002-11-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；HEPES, NaCl, CaCl2, PEG8K, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.30 Å R-free 0.228
1NA1 The structure of HRV14 when complexed with Pleconaril Deposited 2002-11-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；HEPES, NaCl, CaCl2, PEG8K, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.30 Å R-free 0.228
1NCQ The structure of HRV14 when complexed with pleconaril, an antiviral compound Deposited 2002-12-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 60	X-RAY DIFFRACTION X-ray crystallization conditions The crystal was soaked in stabilization buffer containing 2ug/ml pleconaril before data collection	Resolution 2.50 Å R-free 0.217
1NCQ The structure of HRV14 when complexed with pleconaril, an antiviral compound Deposited 2002-12-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 1	X-RAY DIFFRACTION X-ray crystallization conditions The crystal was soaked in stabilization buffer containing 2ug/ml pleconaril before data collection	Resolution 2.50 Å R-free 0.217
1NCQ The structure of HRV14 when complexed with pleconaril, an antiviral compound Deposited 2002-12-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 5	X-RAY DIFFRACTION X-ray crystallization conditions The crystal was soaked in stabilization buffer containing 2ug/ml pleconaril before data collection	Resolution 2.50 Å R-free 0.217
1NCQ The structure of HRV14 when complexed with pleconaril, an antiviral compound Deposited 2002-12-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 6	X-RAY DIFFRACTION X-ray crystallization conditions The crystal was soaked in stabilization buffer containing 2ug/ml pleconaril before data collection	Resolution 2.50 Å R-free 0.217
1NCQ The structure of HRV14 when complexed with pleconaril, an antiviral compound Deposited 2002-12-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 1	X-RAY DIFFRACTION X-ray crystallization conditions The crystal was soaked in stabilization buffer containing 2ug/ml pleconaril before data collection	Resolution 2.50 Å R-free 0.217
1NCQ The structure of HRV14 when complexed with pleconaril, an antiviral compound Deposited 2002-12-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain A 568–856（289 aa） Chain B 70–331（262 aa） Chain C 332–567（236 aa） Chain D 2–69（68 aa）	Not recorded	W11 3-{3,5-DIMETHYL-4-[3-(3-METHYL-ISOXAZOL-5-YL)-PROPOXY]-PHENYL}-5-TRIFLUOROMETHYL-[1,2,4]OXADIAZOLE × 20	X-RAY DIFFRACTION X-ray crystallization conditions The crystal was soaked in stabilization buffer containing 2ug/ml pleconaril before data collection	Resolution 2.50 Å R-free 0.217
1R08 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W42 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-(HYDROXYETHYL OXYMETHYLENEOXYMETHYL) ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1R08 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W42 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-(HYDROXYETHYL OXYMETHYLENEOXYMETHYL) ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1R08 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W42 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-(HYDROXYETHYL OXYMETHYLENEOXYMETHYL) ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1R08 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W42 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-(HYDROXYETHYL OXYMETHYLENEOXYMETHYL) ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1R08 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W42 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-(HYDROXYETHYL OXYMETHYLENEOXYMETHYL) ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1R08 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W42 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-(HYDROXYETHYL OXYMETHYLENEOXYMETHYL) ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1R09 HUMAN RHINOVIRUS 14 COMPLEXED WITH ANTIVIRAL COMPOUND R 61837 Deposited 1990-05-04	Different mutation/modification Different ligand/ion	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	JEN 3-METHOXY-6-[4-(3-METHYLPHENYL)-1-PIPERAZINYL]PYRIDAZINE × 60 DMS DIMETHYL SULFOXIDE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1R09 HUMAN RHINOVIRUS 14 COMPLEXED WITH ANTIVIRAL COMPOUND R 61837 Deposited 1990-05-04	Different mutation/modification Different ligand/ion	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	JEN 3-METHOXY-6-[4-(3-METHYLPHENYL)-1-PIPERAZINYL]PYRIDAZINE × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1R09 HUMAN RHINOVIRUS 14 COMPLEXED WITH ANTIVIRAL COMPOUND R 61837 Deposited 1990-05-04	Different mutation/modification Different ligand/ion	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	JEN 3-METHOXY-6-[4-(3-METHYLPHENYL)-1-PIPERAZINYL]PYRIDAZINE × 5 DMS DIMETHYL SULFOXIDE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1R09 HUMAN RHINOVIRUS 14 COMPLEXED WITH ANTIVIRAL COMPOUND R 61837 Deposited 1990-05-04	Different mutation/modification Different ligand/ion	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	JEN 3-METHOXY-6-[4-(3-METHYLPHENYL)-1-PIPERAZINYL]PYRIDAZINE × 6 DMS DIMETHYL SULFOXIDE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1R09 HUMAN RHINOVIRUS 14 COMPLEXED WITH ANTIVIRAL COMPOUND R 61837 Deposited 1990-05-04	Different mutation/modification Different ligand/ion	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	JEN 3-METHOXY-6-[4-(3-METHYLPHENYL)-1-PIPERAZINYL]PYRIDAZINE × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1R09 HUMAN RHINOVIRUS 14 COMPLEXED WITH ANTIVIRAL COMPOUND R 61837 Deposited 1990-05-04	Different mutation/modification Different ligand/ion	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	JEN 3-METHOXY-6-[4-(3-METHYLPHENYL)-1-PIPERAZINYL]PYRIDAZINE × 20 DMS DIMETHYL SULFOXIDE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUC RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å
1RUC RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å
1RUC RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å
1RUC RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å
1RUC RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å
1RUC RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å
1RUD RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUD RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUD RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUD RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUD RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUD RHINOVIRUS 14 MUTANT N1105S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S Mutation：N(1)105S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUF RHINOVIRUS 14 (HRV14) (MUTANT WITH ASN 1 219 REPLACED BY ALA (N219A IN CHAIN 1) Deposited 1995-06-09	Different construct Different ligand/ion	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 568–856（289 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUF RHINOVIRUS 14 (HRV14) (MUTANT WITH ASN 1 219 REPLACED BY ALA (N219A IN CHAIN 1) Deposited 1995-06-09	Different construct Different ligand/ion	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 568–856（289 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUF RHINOVIRUS 14 (HRV14) (MUTANT WITH ASN 1 219 REPLACED BY ALA (N219A IN CHAIN 1) Deposited 1995-06-09	Different construct Different ligand/ion	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 568–856（289 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUF RHINOVIRUS 14 (HRV14) (MUTANT WITH ASN 1 219 REPLACED BY ALA (N219A IN CHAIN 1) Deposited 1995-06-09	Different construct Different ligand/ion	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 568–856（289 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUF RHINOVIRUS 14 (HRV14) (MUTANT WITH ASN 1 219 REPLACED BY ALA (N219A IN CHAIN 1) Deposited 1995-06-09	Different construct Different ligand/ion	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 568–856（289 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUF RHINOVIRUS 14 (HRV14) (MUTANT WITH ASN 1 219 REPLACED BY ALA (N219A IN CHAIN 1) Deposited 1995-06-09	Different construct Different ligand/ion	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 568–856（289 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A Mutation：N(1)219A	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1RUG RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUG RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUG RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUG RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUG RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUG RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035 Deposited 1995-06-09	Different mutation/modification Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUH RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUH RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUH RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUH RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUH RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUH RHINOVIRUS 14 MUTANT N1219S COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S Mutation：N(1)219S	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUI RHINOVIRUS 14 MUTANT S1223G COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUI RHINOVIRUS 14 MUTANT S1223G COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUI RHINOVIRUS 14 MUTANT S1223G COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUI RHINOVIRUS 14 MUTANT S1223G COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUI RHINOVIRUS 14 MUTANT S1223G COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUI RHINOVIRUS 14 MUTANT S1223G COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52084 Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUJ RHINOVIRUS 14 MUTANT WITH SER 1 223 REPLACED BY GLY (S1223G) Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUJ RHINOVIRUS 14 MUTANT WITH SER 1 223 REPLACED BY GLY (S1223G) Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUJ RHINOVIRUS 14 MUTANT WITH SER 1 223 REPLACED BY GLY (S1223G) Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUJ RHINOVIRUS 14 MUTANT WITH SER 1 223 REPLACED BY GLY (S1223G) Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUJ RHINOVIRUS 14 MUTANT WITH SER 1 223 REPLACED BY GLY (S1223G) Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RUJ RHINOVIRUS 14 MUTANT WITH SER 1 223 REPLACED BY GLY (S1223G) Deposited 1995-06-09	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G Mutation：S(1)223G	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1RVF FAB COMPLEXED WITH INTACT HUMAN RHINOVIRUS Deposited 1996-09-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 4.00 Å
1RVF FAB COMPLEXED WITH INTACT HUMAN RHINOVIRUS Deposited 1996-09-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 4.00 Å
1RVF FAB COMPLEXED WITH INTACT HUMAN RHINOVIRUS Deposited 1996-09-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 4.00 Å
1RVF FAB COMPLEXED WITH INTACT HUMAN RHINOVIRUS Deposited 1996-09-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 4.00 Å
1RVF FAB COMPLEXED WITH INTACT HUMAN RHINOVIRUS Deposited 1996-09-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 4.00 Å
1RVF FAB COMPLEXED WITH INTACT HUMAN RHINOVIRUS Deposited 1996-09-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 120 PDB declaration: 120-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 4.00 Å
1VRH HRV14/SDZ 880-061 COMPLEX Deposited 1996-02-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: complete icosahedral assembly	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L	SD8 2-[4-(2H-1,4-BENZOTHIAZINE-3-YL)-PIPERAZINE-1-LY]-1,3-THIAZOLE-4-CARBOXYLIC ACID ETHYLESTER × 60	X-RAY DIFFRACTION X-ray crystallization conditions 5 MG/ML OF SDZ 880-061 IN 200 MICROLITER DROPS FOR 3 - 4 CRYSTALS	Resolution 3.00 Å
1VRH HRV14/SDZ 880-061 COMPLEX Deposited 1996-02-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L	SD8 2-[4-(2H-1,4-BENZOTHIAZINE-3-YL)-PIPERAZINE-1-LY]-1,3-THIAZOLE-4-CARBOXYLIC ACID ETHYLESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions 5 MG/ML OF SDZ 880-061 IN 200 MICROLITER DROPS FOR 3 - 4 CRYSTALS	Resolution 3.00 Å
1VRH HRV14/SDZ 880-061 COMPLEX Deposited 1996-02-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L	SD8 2-[4-(2H-1,4-BENZOTHIAZINE-3-YL)-PIPERAZINE-1-LY]-1,3-THIAZOLE-4-CARBOXYLIC ACID ETHYLESTER × 5	X-RAY DIFFRACTION X-ray crystallization conditions 5 MG/ML OF SDZ 880-061 IN 200 MICROLITER DROPS FOR 3 - 4 CRYSTALS	Resolution 3.00 Å
1VRH HRV14/SDZ 880-061 COMPLEX Deposited 1996-02-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L	SD8 2-[4-(2H-1,4-BENZOTHIAZINE-3-YL)-PIPERAZINE-1-LY]-1,3-THIAZOLE-4-CARBOXYLIC ACID ETHYLESTER × 6	X-RAY DIFFRACTION X-ray crystallization conditions 5 MG/ML OF SDZ 880-061 IN 200 MICROLITER DROPS FOR 3 - 4 CRYSTALS	Resolution 3.00 Å
1VRH HRV14/SDZ 880-061 COMPLEX Deposited 1996-02-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L	SD8 2-[4-(2H-1,4-BENZOTHIAZINE-3-YL)-PIPERAZINE-1-LY]-1,3-THIAZOLE-4-CARBOXYLIC ACID ETHYLESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions 5 MG/ML OF SDZ 880-061 IN 200 MICROLITER DROPS FOR 3 - 4 CRYSTALS	Resolution 3.00 Å
1VRH HRV14/SDZ 880-061 COMPLEX Deposited 1996-02-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L Mutation：I(2 170)L	SD8 2-[4-(2H-1,4-BENZOTHIAZINE-3-YL)-PIPERAZINE-1-LY]-1,3-THIAZOLE-4-CARBOXYLIC ACID ETHYLESTER × 20	X-RAY DIFFRACTION X-ray crystallization conditions 5 MG/ML OF SDZ 880-061 IN 200 MICROLITER DROPS FOR 3 - 4 CRYSTALS	Resolution 3.00 Å
1XR5 Crystal Structure of the RNA-dependent RNA Polymerase 3D from human rhinovirus serotype 14 Deposited 2004-10-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1720–2179（460 aa） Fragment：RNA-DIRECTED RNA POLYMERASE	Not recorded	SM SAMARIUM (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；286 K；sodium formate, glycerol, pH 7.00, VAPOR DIFFUSION, HANGING DROP, temperature 286K	Resolution 2.80 Å R-free 0.293
2B0F NMR Structure of the Human Rhinovirus 3C Protease (serotype 14) with covalently bound Ace-LEALFQ-ethylpropionate inhibitor Deposited 2005-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1538–1719（182 aa） Fragment：Human Rhinovirus serotype 14 3C Protease	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；25 K；Ionic strength (raw mmCIF value) 20mM KH2PO4；Pressure ambient NMR measurement conditions pH 6.5；25 K；Ionic strength (raw mmCIF value) 20mM KH2PO4；Pressure ambient NMR sample composition 0.75mM HRV14-3C with covalent inhibitor 20mM KH2PO4 15mM DTT 0.5mM EDTA 0.1mM DSS pH 6.5; 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.75mM HRV14-3C with covalent inhibitor 20mM KH2PO4 15mM DTT 0.5mM EDTA 0.1mM DSS pD 6.5; 99.96% D2O \| 99.96% D2O	Resolution not provided
2HWB A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W91 5-(3-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PROPYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWB A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W91 5-(3-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PROPYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWB A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W91 5-(3-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PROPYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWB A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W91 5-(3-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PROPYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWB A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W91 5-(3-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PROPYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWB A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W91 5-(3-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PROPYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWC A COMPARISON OF THE ANTI-RHINOVIRAL DRUG BINDING POCKET IN HRV14 AND HRV1A Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W54 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWC A COMPARISON OF THE ANTI-RHINOVIRAL DRUG BINDING POCKET IN HRV14 AND HRV1A Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W54 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWC A COMPARISON OF THE ANTI-RHINOVIRAL DRUG BINDING POCKET IN HRV14 AND HRV1A Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W54 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWC A COMPARISON OF THE ANTI-RHINOVIRAL DRUG BINDING POCKET IN HRV14 AND HRV1A Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W54 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWC A COMPARISON OF THE ANTI-RHINOVIRAL DRUG BINDING POCKET IN HRV14 AND HRV1A Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W54 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2HWC A COMPARISON OF THE ANTI-RHINOVIRAL DRUG BINDING POCKET IN HRV14 AND HRV1A Deposited 1994-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W54 5-(5-(2,6-DICHLORO-4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2IN2 NMR Structure of the Apo Human Rhinovirus 3C Protease (serotype 14) Deposited 2006-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1537–1718（182 aa） Fragment：Human Rhinovirus 3C Protease	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 20 mM；Pressure 1 NMR sample composition U-13C/15N; 20mM phosphate buffer; 0.5mM EDTA; 15mM DTT; 0.3% NaN3; 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition U-13C/15N; 20mM phosphate buffer; 0.5mM EDTA; 15mM DTT; NaN3; 99.6% D2O \| 99.6% D2O NMR sample composition U-15N; 20mM phosphate buffer; 0.5mM EDTA; 15mM DTT; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2R04 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R04 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R04 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R04 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R04 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R04 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R06 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R06 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R06 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R06 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R06 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R06 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W35 5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R07 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W33 5-(5-(6-CHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R07 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W33 5-(5-(6-CHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R07 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W33 5-(5-(6-CHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R07 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W33 5-(5-(6-CHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R07 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W33 5-(5-(6-CHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2R07 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W33 5-(5-(6-CHLORO-4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RM2 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W43 5-(7-(6-CHLORO-4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RM2 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W43 5-(7-(6-CHLORO-4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RM2 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W43 5-(7-(6-CHLORO-4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RM2 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W43 5-(7-(6-CHLORO-4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RM2 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W43 5-(7-(6-CHLORO-4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RM2 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W43 5-(7-(6-CHLORO-4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RMU THREE-DIMENSIONAL STRUCTURES OF DRUG-RESISTANT MUTANTS OF HUMAN RHINOVIRUS 14 Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RR1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W8R 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RR1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W8R 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RR1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W8R 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RR1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W8R 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RR1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W8R 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RR1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W8R 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS1 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W84 5-(7-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS3 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W59 5-(7-(5-HYDRO-4-ETHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS3 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W59 5-(7-(5-HYDRO-4-ETHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS3 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W59 5-(7-(5-HYDRO-4-ETHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS3 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W59 5-(7-(5-HYDRO-4-ETHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS3 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W59 5-(7-(5-HYDRO-4-ETHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS3 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W59 5-(7-(5-HYDRO-4-ETHYL-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS5 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W56 5-(5-(4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS5 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W56 5-(5-(4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS5 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W56 5-(5-(4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS5 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W56 5-(5-(4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS5 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W56 5-(5-(4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2RS5 STRUCTURAL ANALYSIS OF ANTIVIRAL AGENTS THAT INTERACT WITH THE CAPSID OF HUMAN RHINOVIRUSES Deposited 1988-10-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	W56 5-(5-(4-(5-HYDRO-4-METHYL-2-OXAZOLYL)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE × 20	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
4PDW A benzonitrile analogue inhibits rhinovirus replication Deposited 2014-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 240 PDB declaration: 240-meric	Chain A 568–856（289 aa） Fragment：resdiues 568-856 Chain B 70–331（262 aa） Fragment：resdiues 70-331 Chain C 332–567（236 aa） Fragment：resdiues 332-657	Not recorded	GOL GLYCEROL × 240 2XK 4-[(4,5-dimethoxy-2-nitrophenyl)acetyl]benzonitrile × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293.15 K；PEG 8000, calcium chloride	Resolution 3.00 Å R-free 0.200
4PDW A benzonitrile analogue inhibits rhinovirus replication Deposited 2014-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 568–856（289 aa） Fragment：resdiues 568-856 Chain B 70–331（262 aa） Fragment：resdiues 70-331 Chain C 332–567（236 aa） Fragment：resdiues 332-657	Not recorded	GOL GLYCEROL × 4 2XK 4-[(4,5-dimethoxy-2-nitrophenyl)acetyl]benzonitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293.15 K；PEG 8000, calcium chloride	Resolution 3.00 Å R-free 0.200
4PDW A benzonitrile analogue inhibits rhinovirus replication Deposited 2014-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain A 568–856（289 aa） Fragment：resdiues 568-856 Chain B 70–331（262 aa） Fragment：resdiues 70-331 Chain C 332–567（236 aa） Fragment：resdiues 332-657	Not recorded	GOL GLYCEROL × 20 2XK 4-[(4,5-dimethoxy-2-nitrophenyl)acetyl]benzonitrile × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293.15 K；PEG 8000, calcium chloride	Resolution 3.00 Å R-free 0.200
4PDW A benzonitrile analogue inhibits rhinovirus replication Deposited 2014-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 568–856（289 aa） Fragment：resdiues 568-856 Chain B 70–331（262 aa） Fragment：resdiues 70-331 Chain C 332–567（236 aa） Fragment：resdiues 332-657	Not recorded	GOL GLYCEROL × 24 2XK 4-[(4,5-dimethoxy-2-nitrophenyl)acetyl]benzonitrile × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293.15 K；PEG 8000, calcium chloride	Resolution 3.00 Å R-free 0.200
4PDW A benzonitrile analogue inhibits rhinovirus replication Deposited 2014-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 568–856（289 aa） Fragment：resdiues 568-856 Chain B 70–331（262 aa） Fragment：resdiues 70-331 Chain C 332–567（236 aa） Fragment：resdiues 332-657	Not recorded	GOL GLYCEROL × 4 2XK 4-[(4,5-dimethoxy-2-nitrophenyl)acetyl]benzonitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293.15 K；PEG 8000, calcium chloride	Resolution 3.00 Å R-free 0.200
4RHV THE USE OF MOLECULAR-REPLACEMENT PHASES FOR THE REFINEMENT OF THE HUMAN RHINOVIRUS 14 STRUCTURE Deposited 1988-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
4RHV THE USE OF MOLECULAR-REPLACEMENT PHASES FOR THE REFINEMENT OF THE HUMAN RHINOVIRUS 14 STRUCTURE Deposited 1988-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
4RHV THE USE OF MOLECULAR-REPLACEMENT PHASES FOR THE REFINEMENT OF THE HUMAN RHINOVIRUS 14 STRUCTURE Deposited 1988-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
4RHV THE USE OF MOLECULAR-REPLACEMENT PHASES FOR THE REFINEMENT OF THE HUMAN RHINOVIRUS 14 STRUCTURE Deposited 1988-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
4RHV THE USE OF MOLECULAR-REPLACEMENT PHASES FOR THE REFINEMENT OF THE HUMAN RHINOVIRUS 14 STRUCTURE Deposited 1988-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
4RHV THE USE OF MOLECULAR-REPLACEMENT PHASES FOR THE REFINEMENT OF THE HUMAN RHINOVIRUS 14 STRUCTURE Deposited 1988-01-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain 1 567–855（289 aa） Chain 2 69–330（262 aa） Chain 3 331–566（236 aa） Chain 4 1–68（68 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
5W3E CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
5W3E CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
5W3E CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
5W3E CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
5W3E CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
5W3L CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
5W3L CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
5W3L CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
5W3L CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
5W3L CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar ratio 1:3, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
5W3M CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:1, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.26 Å
5W3M CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:1, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.26 Å
5W3M CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:1, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.26 Å
5W3M CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:1, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.26 Å
5W3M CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:1, full particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331 Chain D 2–69（68 aa） Fragment：UNP residues 2-69	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.26 Å
5W3O CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, empty particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
5W3O CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, empty particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
5W3O CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, empty particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
5W3O CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, empty particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
5W3O CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, empty particle) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 568–856（289 aa） Fragment：UNP residues 568-856 Chain B 332–567（236 aa） Fragment：UNP residues 332-567 Chain C 70–331（262 aa） Fragment：UNP residues 70-331	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, 120 mM sodium chloride, 1 mM EDTA, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
6HLT Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of rhinovirus-14 (HRV14) Deposited 2018-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1430–1485（56 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；10% w/v PEG 8000, 20% v/v ethylene glycol, 30 mM MgCl2, 30 mM CaCl2, 100 mM bicine/Tris pH 8.5	Resolution 2.81 Å R-free 0.239
6HLT Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of rhinovirus-14 (HRV14) Deposited 2018-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1430–1485（56 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；10% w/v PEG 8000, 20% v/v ethylene glycol, 30 mM MgCl2, 30 mM CaCl2, 100 mM bicine/Tris pH 8.5	Resolution 2.81 Å R-free 0.239
6KYZ HRV14 3C in complex with single chain antibody YDF Deposited 2019-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1538–1719（182 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.1 M citrate 40% PEG600	Resolution 1.84 Å R-free 0.208
6KYZ HRV14 3C in complex with single chain antibody YDF Deposited 2019-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1538–1719（182 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.1 M citrate 40% PEG600	Resolution 1.84 Å R-free 0.208
6KZ0 HRV14 3C in complex with single chain antibody GGVV Deposited 2019-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1538–1719（182 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；293 K；0.1 M Tris-HCl, 25% MPEG5000, 0.2 M Li2SO4	Resolution 2.40 Å R-free 0.223
6KZ0 HRV14 3C in complex with single chain antibody GGVV Deposited 2019-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1538–1719（182 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；293 K；0.1 M Tris-HCl, 25% MPEG5000, 0.2 M Li2SO4	Resolution 2.40 Å R-free 0.223
6KZ0 HRV14 3C in complex with single chain antibody GGVV Deposited 2019-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1538–1719（182 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；293 K；0.1 M Tris-HCl, 25% MPEG5000, 0.2 M Li2SO4	Resolution 2.40 Å R-free 0.223
6KZ0 HRV14 3C in complex with single chain antibody GGVV Deposited 2019-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 1538–1719（182 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；293 K；0.1 M Tris-HCl, 25% MPEG5000, 0.2 M Li2SO4	Resolution 2.40 Å R-free 0.223
7BG6 HRV14 native particle solved by cryoEM Deposited 2021-01-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 240 PDB declaration: 300-meric	Chain 1 584–856（273 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS with ph = 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
7BG7 HRV14 in complex with its receptor ICAM-1 Deposited 2021-01-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain 1 564–856（293 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
7NUL Rhinovirus-14 ICAM-1 activated particle at pH 6.2 Deposited 2021-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 300-meric	Chain 1 564–856（293 aa） Chain 2 70–331（262 aa） Chain 3 332–563（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
7NUM Rhinovirus-14 ICAM-1 empty particle at pH 6.2 Deposited 2021-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 300-meric	Chain 1 564–856（293 aa） Chain 2 70–331（262 aa） Chain 3 332–563（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7NUN Rhinovirus 14 ICAM-1 virion-like particle at pH 6.2 Deposited 2021-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 240 PDB declaration: 300-meric	Chain 1 564–856（293 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7NUO Rhinovirus 14 empty particle at pH 6.2 Deposited 2021-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 300-meric	Chain 1 564–856（293 aa） Chain 2 70–331（262 aa） Chain 3 332–563（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7NUQ Rhinovirus 14 virion-like at pH 6.2 Deposited 2021-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 240 PDB declaration: 300-meric	Chain 1 564–856（293 aa） Chain 2 70–331（262 aa） Chain 3 332–567（236 aa） Chain 4 2–69（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8PNB HRV empty capsid Deposited 2023-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: trimeric	Chain 1 627–856（230 aa） Chain 2 76–331（256 aa） Chain 3 332–567（236 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8PNF HRV B14 virion proteins Deposited 2023-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions	Assembly 1 Protein–RNA Homooligomer；Protein × 240 PDB declaration: 300-meric	Chain 1 574–856（283 aa） Chain 2 76–331（256 aa） Chain 3 332–567（236 aa） Chain 4 23–69（47 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9LGP Crystal structure of the HRV B14 3C protease in complex with AG7404 Deposited 2025-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1538–1719（182 aa）	Not recorded	XNV ethyl (4R)-4-({(2S)-2-[3-{[(5-methyl-1,2-oxazol-3-yl)carbonyl]amino}-2-oxopyridin-1(2H)-yl]pent-4-ynoyl}amino)-5-[(3S)-2-oxopyrrolidin-3-yl]pentanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；289.15 K；0.1 M Tris-HCl, 0.8 M Lithium chloride, 36%(w/v) PEG 4000	Resolution 2.11 Å R-free 0.267
9LGP Crystal structure of the HRV B14 3C protease in complex with AG7404 Deposited 2025-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1538–1719（182 aa）	Not recorded	XNV ethyl (4R)-4-({(2S)-2-[3-{[(5-methyl-1,2-oxazol-3-yl)carbonyl]amino}-2-oxopyridin-1(2H)-yl]pent-4-ynoyl}amino)-5-[(3S)-2-oxopyrrolidin-3-yl]pentanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；289.15 K；0.1 M Tris-HCl, 0.8 M Lithium chloride, 36%(w/v) PEG 4000	Resolution 2.11 Å R-free 0.267
9LGP Crystal structure of the HRV B14 3C protease in complex with AG7404 Deposited 2025-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1538–1719（182 aa）	Not recorded	XNV ethyl (4R)-4-({(2S)-2-[3-{[(5-methyl-1,2-oxazol-3-yl)carbonyl]amino}-2-oxopyridin-1(2H)-yl]pent-4-ynoyl}amino)-5-[(3S)-2-oxopyrrolidin-3-yl]pentanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；289.15 K；0.1 M Tris-HCl, 0.8 M Lithium chloride, 36%(w/v) PEG 4000	Resolution 2.11 Å R-free 0.267
9LGP Crystal structure of the HRV B14 3C protease in complex with AG7404 Deposited 2025-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1538–1719（182 aa）	Not recorded	XNV ethyl (4R)-4-({(2S)-2-[3-{[(5-methyl-1,2-oxazol-3-yl)carbonyl]amino}-2-oxopyridin-1(2H)-yl]pent-4-ynoyl}amino)-5-[(3S)-2-oxopyrrolidin-3-yl]pentanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；289.15 K；0.1 M Tris-HCl, 0.8 M Lithium chloride, 36%(w/v) PEG 4000	Resolution 2.11 Å R-free 0.267
9U5P HRV14 3C in complex with single chain antibody YDF and cloverleafRNA-dimer conformation Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 6 PDB declaration: heptameric	Chain A 1539–1718（180 aa） Chain O 1539–1718（180 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.96 Å
9U5Q HRV14 3C in complex with single chain antibody YDF and cloverleafRNA-conformation1 Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain A 1539–1718（180 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
9U5R HRV14 3C in complex with single chain antibody YDF and cloverleafRNA-conformation 2 Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain O 1539–1718（180 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.59 Å
9URM HRV14 3C in complex with single chain antibody YDF and cloverleafRNA-conformation1 splitRNA Deposited 2025-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain A 1539–1718（180 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.24 Å
9VMD HRV14 3C in complex with single chain antibody YDF and cloverleafRNA-conformation2 splitRNA Deposited 2025-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain O 1539–1718（180 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 4.38 Å
9WB3 HRV14 3C in complex with single chain antibody YDF and cloverleafRNA-conformation1-composite-1 Deposited 2025-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain A 1539–1718（180 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9WB4 HRV14 3C in complex with single chain antibody YDF and cloverleafRNA-conformation1-composite-2 Deposited 2025-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain A 1539–1718（180 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å

58 other PDB entries and 235 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLG_HRV14
Isoform	—
PDB entities	1, 2, 3, 4
Chains and sequence ranges	Author chain 1； PDBConstruct 1–289； UniProt 567–855 Author chain 2； PDBConstruct 1–262； UniProt 69–330 Author chain 3； PDBConstruct 1–236； UniProt 331–566 Author chain 4； PDBConstruct 1–68； UniProt 1–68

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1rue
Deposition date deposition_date	1995-06-09
Structure title title	RHINOVIRUS 14 SITE DIRECTED MUTANT N1219A COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035
Keywords keywords	RHINOVIRUS COAT PROTEIN, Icosahedral virus, Virus; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.64 Å
Radius of gyration Rg (electron density) rg_electron	28.59 Å
Forward intensity I(0) i0	125597000.00
Molecular weight molecular_weight	89256.0 kDa
Excluded volume excluded_volume	111900 Å³
Envelope volume envelope_volume	137090 Å³
Hydration-shell volume shell_volume	39266 Å³
Envelope diameter envelope_diameter	102.3 Å
Shell Rg shell_rg	36.36 Å
Envelope Rg envelope_rg	29.33 Å
Shape Rg shape_rg	28.61 Å
Total Rg total_rg	29.27 Å
Total atoms total_atoms	6288
Residues n_residues	804
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	96.3 Å
Rg (real space) rg_real	29.62 Å
Rg uncertainty (real space) rg_real_error	0.66 Å
I(0) (real space) i0_real	1.2560e+08
I(0) uncertainty (real space) i0_real_error	1.8870e+06
Rg (reciprocal space) rg_reciprocal	29.63 Å
I(0) (reciprocal space) i0_reciprocal	125600000.0000
Solution quality estimate total_estimate	0.8879
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	34.5 Å
Skewness Skewness skewness	0.363
Kurtosis Kurtosis kurtosis	-0.271
Angular range angular_range	— – 0.2650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	23460000.0000
Real-space data points n_real_points	54
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.874; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.915

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	RHINOVIRUS 14
Molecular weight formula_weight	32517.5 kDa
Mutation mutation	N(1)219A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	6288

GLGDELEEVIVEKTKQTVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLAHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY

来源 Source

来源生物 organism	Human rhinovirus 14
NCBI Class编号 ncbi_taxonomy_id	12131
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	RHINOVIRUS 14
Molecular weight formula_weight	28501.4 kDa
Mutation mutation	N(1)219A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SPNVEACGYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ

来源 Source

来源生物 organism	Human rhinovirus 14
NCBI Class编号 ncbi_taxonomy_id	12131
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	RHINOVIRUS 14
Molecular weight formula_weight	26236.8 kDa
Mutation mutation	N(1)219A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE

来源 Source

来源生物 organism	Human rhinovirus 14
NCBI Class编号 ncbi_taxonomy_id	12131
宿主生物 host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	RHINOVIRUS 14
Molecular weight formula_weight	7183.9 kDa
Mutation mutation	N(1)219A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN

来源 Source

来源生物 organism	Human rhinovirus 14
NCBI Class编号 ncbi_taxonomy_id	12131
宿主生物 host_organism	Homo sapiens

Entity 5 Entity 5 non-polymer

Description description	5-(5-(4-(4,5-DIHYDRO-2-OXAZOLY)PHENOXY)PENTYL)-3-METHYL ISOXAZOLE
Molecular weight formula_weight	314.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1rue.1
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

Domain ID domain_id	d1rue1_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

Domain ID domain_id	d1rue3_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

CATH v4.4 (4 domains)

Domain ID domain_id	1rue100
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rue200
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rue300
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rue400
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	80 — Rhinovirus 14, subunit 4
Homologous superfamily homologous superfamily	10 — Picornavirus coat protein VP4

▶

8. Citations (12)

Structural studies on human rhinovirus 14 drug-resistant compensation mutants.

J.Mol.Biol. (1995)

PMID: 7473717 · DOI: 10.1006/jmbi.1995.0536 PRIMARY

Win 52035-2 Inhibits Both Attachment and Eclipse of Human Rhinovirus 14

J.Virol. (1993)

Analysis of the Structure of a Common Cold Virus, Human Rhinovirus 14, Refined at a Resolution of 3.0 Angstroms

J.Mol.Biol. (1990)

Three Dimensional Structures of Drug-Resistant Mutants of Human Rhinovirus 14

J.Mol.Biol. (1989)

Structural Analysis of Antiviral Agents that Interact with the Capsid of Human Rhinoviruses

Proteins (1989)

Genetics and Molecular Basis for Resistance of Human Rhinovirus 14 to an Antiviral Drug

J.Virol. (1989)

The Use of Molecular Replacement Phases for the Refinement of the Human Rhinovirus 14 Structure

Acta Crystallogr.,Sect.A (1988)

Structural Analysis of a Series of Antiviral Agents Complexed with Human Rhinovirus 14

Proc.Natl.Acad.Sci.USA (1988)

The Structure Determination of a Common Cold Virus, Human Rhinovirus 14

Acta Crystallogr.,Sect.A (1987)

The Site of Attachment in Human Rhinovirus 14 for Antiviral Agents that Inhibit Uncoating

Science (1986)

Structure of a Human Common Cold Virus and Functional Relationship to Other Picornaviruses

Nature (1985)

Virion Orientation in Cubic Crystals of the Human Common Cold Virus Hrv14

J.Mol.Biol. (1984)

▶

Unit-cell length a length_a	445.100 Å
Unit-cell length b length_b	445.100 Å
Unit-cell length c length_c	445.100 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	240

Space group space_group	P 21 3
Space-group number int_tables_number	198
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

fit	/app/data/saxs_computation/ru/1rue/1rue.fit
pddf	/app/data/pr_computation/ru/1rue/1rue.pr.out
profile	/app/data/saxs_computation/ru/1rue/1rue.dat

RHINOVIRUS 14 SITE DIRECTED MUTANT N1219A COMPLEXED WITH ANTIVIRAL COMPOUND WIN 52035

1. Protein Identity and Related Structures Protein Identity & Related Structures

RHINOVIRUS 14

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 non-polymer

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

8. Citations (12)

9. Files and Curves (10)

Files (7)

Curves (3)