SAXSdb — 1t2k

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interferon regulatory factor 3

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 4 DNA 2 PDB declaration: hexameric（6） Consistent with all polymer counts	Chain A； UniProt 1–112 Chain B； UniProt 1–112	Fragment：N-terminal DNA binding domain	31-MER × 1 31-MER × 1 Transcription factor AP-1 × 1 （P05412） Cyclic-AMP-dependent transcription factor ATF-2 × 1 （P15336）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；100 mM NaCacodylate, pH 6.5, 12.5% (w/v) PEG 6000, 400 mM NH4OAc, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.00 Å R-free 0.296

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1T2K	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1J2F X-ray crystal structure of IRF-3 and its functional implications Deposited 2003-01-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 175–427（253 aa） Fragment：residues 170-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；277 K；magnesium formate, pH 4.2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.242
1J2F X-ray crystal structure of IRF-3 and its functional implications Deposited 2003-01-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 175–427（253 aa） Fragment：residues 170-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；277 K；magnesium formate, pH 4.2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.242
1QWT Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain Deposited 2003-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 173–427（255 aa） Chain B 173–427（255 aa）	Not recorded	PO4 PHOSPHATE ION × 8	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.214
1ZOQ IRF3-CBP complex Deposited 2005-05-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 196–386（191 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；0.2 M ammonium acetate, 0.15 M Mg acetate, 5% (v/v) PEG 4000, 50 mM Na HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.37 Å R-free 0.226
1ZOQ IRF3-CBP complex Deposited 2005-05-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 196–386（191 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；0.2 M ammonium acetate, 0.15 M Mg acetate, 5% (v/v) PEG 4000, 50 mM Na HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.37 Å R-free 0.226
2O61 Crystal Structure of NFkB, IRF7, IRF3 bound to the interferon-b enhancer Deposited 2006-12-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 9–111（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；100 mM HEPES, pH 7.0, 15% (w/v) PEG 4000, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.80 Å R-free 0.278
2O6G Crystal structure of IRF-3 bound to the interferon-b enhancer Deposited 2006-12-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain E 1–123（123 aa） Fragment：DNA binding domain, residues 3-112 Chain F 1–123（123 aa） Fragment：DNA binding domain, residues 3-112 Chain G 1–123（123 aa） Fragment：DNA binding domain, residues 3-112 Chain H 1–123（123 aa） Fragment：DNA binding domain, residues 3-112	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；294 K；100 mM Tris, 20% (w/v) PEG 6000, 500 mM NH4OAc, 100 mM NaCl, 5 mM MgCl2, 5% glycerol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 3.10 Å R-free 0.265
2PI0 Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-B enhancer Deposited 2007-04-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–113（113 aa） Fragment：IRF-3 DNA Binding Domain Chain B 1–113（113 aa） Fragment：IRF-3 DNA Binding Domain Chain C 1–113（113 aa） Fragment：IRF-3 DNA Binding Domain Chain D 1–113（113 aa） Fragment：IRF-3 DNA Binding Domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；12%PEG 400,200mM NaCl, pH 7., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.31 Å R-free 0.264
3A77 The crystal structure of phosphorylated IRF-3 Deposited 2009-09-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACY ACETIC ACID × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；10% MPD, 50mM sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.80 Å R-free 0.221
3A77 The crystal structure of phosphorylated IRF-3 Deposited 2009-09-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 189–427（239 aa） Fragment：UNP residues 189-427	Non-standard monomer：Yes (specific site not provided by mmCIF)	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；10% MPD, 50mM sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.80 Å R-free 0.221
3A77 The crystal structure of phosphorylated IRF-3 Deposited 2009-09-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 189–427（239 aa） Fragment：UNP residues 189-427	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACY ACETIC ACID × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；10% MPD, 50mM sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.80 Å R-free 0.221
3A77 The crystal structure of phosphorylated IRF-3 Deposited 2009-09-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 189–427（239 aa） Fragment：UNP residues 189-427	Non-standard monomer：Yes (specific site not provided by mmCIF)	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；10% MPD, 50mM sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.80 Å R-free 0.221
5JEJ Phosphorylated STING in complex with IRF-3 CTD Deposited 2016-04-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427 Chain B 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris, pH 5.5, 200 mM MgCl2, 20% PEG 3350	Resolution 2.00 Å R-free 0.237
5JEK Phosphorylated MAVS in complex with IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris pH 5.5, 80 mM MgCl2, 20% PEG 3350	Resolution 2.40 Å R-free 0.251
5JEK Phosphorylated MAVS in complex with IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris pH 5.5, 80 mM MgCl2, 20% PEG 3350	Resolution 2.40 Å R-free 0.251
5JEL Phosphorylated TRIF in complex with IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M NaAc pH 4.6, 2.0M NaCl	Resolution 1.60 Å R-free 0.187
5JEL Phosphorylated TRIF in complex with IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M NaAc pH 4.6, 2.0M NaCl	Resolution 1.60 Å R-free 0.187
5JEM Complex of IRF-3 with CBP Deposited 2016-04-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 189–398（210 aa） Fragment：UNP residues 189-398 Chain B 189–398（210 aa） Fragment：UNP residues 189-398	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M HEPES pH 7.5, 25% PEG 3350	Resolution 2.50 Å R-free 0.242
5JEM Complex of IRF-3 with CBP Deposited 2016-04-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 189–398（210 aa） Fragment：UNP residues 189-398 Chain G 189–398（210 aa） Fragment：UNP residues 189-398	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M HEPES pH 7.5, 25% PEG 3350	Resolution 2.50 Å R-free 0.242
5JEO Phosphorylated Rotavirus NSP1 in complex with IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M HEPES sodium pH7.5, 0.8 M NaH2PO4, 0.8 M KH2PO4	Resolution 1.72 Å R-free 0.183
5JEO Phosphorylated Rotavirus NSP1 in complex with IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	PO4 PHOSPHATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M HEPES sodium pH7.5, 0.8 M NaH2PO4, 0.8 M KH2PO4	Resolution 1.72 Å R-free 0.183
5JER Structure of Rotavirus NSP1 bound to IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris pH 5.5, 200 mM MgCl2, 23% PEG 3350	Resolution 2.91 Å R-free 0.250
5JER Structure of Rotavirus NSP1 bound to IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris pH 5.5, 200 mM MgCl2, 23% PEG 3350	Resolution 2.91 Å R-free 0.250
5JER Structure of Rotavirus NSP1 bound to IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris pH 5.5, 200 mM MgCl2, 23% PEG 3350	Resolution 2.91 Å R-free 0.250
5JER Structure of Rotavirus NSP1 bound to IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris pH 5.5, 200 mM MgCl2, 23% PEG 3350	Resolution 2.91 Å R-free 0.250
5JER Structure of Rotavirus NSP1 bound to IRF-3 Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 189–427（239 aa） Fragment：UNP residues 189-427 Chain C 189–427（239 aa） Fragment：UNP residues 189-427 Chain E 189–427（239 aa） Fragment：UNP residues 189-427 Chain G 189–427（239 aa） Fragment：UNP residues 189-427	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris pH 5.5, 200 mM MgCl2, 23% PEG 3350	Resolution 2.91 Å R-free 0.250
6SIV Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif Deposited 2019-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 137–148（12 aa）	Mutation：;K84A,K240A,E360A,K363A,D364A,N2146E,M2147E,V2148R,K84A,K240A,E360A,K363A,D364A,N2146E,M2147E,V2148R,K84A,K240A,E360A,K363A,D364A,N2146E,M2147E,V2148R,K84A,K240A,E360A,K363A,D364A,N2146E,M2147E,V2148R ;	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；PEG 1500 30%	Resolution 1.75 Å R-free 0.220
6SJA Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif Deposited 2019-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 137–148（12 aa）	Mutation：E360A,K363A,D364A,K84A,K240A	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.8；298 K；PEG 1500 30%	Resolution 1.50 Å R-free 0.191
7JFL Crystal structure of human phosphorylated IRF-3 bound to CBP Deposited 2020-07-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 189–398（210 aa） Chain B 189–398（210 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；0.1 M sodium acetate pH 5.0, 0.2 M MgCl2, 5% PEG 3350	Resolution 1.68 Å R-free 0.223

16 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IRF3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–112； UniProt 1–112 Author chain B； PDBConstruct 1–112； UniProt 1–112

Transcription factor AP-1

Homo sapiens

UniProt P05412

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 4 DNA 2 PDB declaration: hexameric（6） Consistent with all polymer counts	Chain C； UniProt 254–314	Fragment：bZip domain Mutation：C269S	31-MER × 1 31-MER × 1 Interferon regulatory factor 3 × 2 （Q14653） Cyclic-AMP-dependent transcription factor ATF-2 × 1 （P15336）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；100 mM NaCacodylate, pH 6.5, 12.5% (w/v) PEG 6000, 400 mM NH4OAc, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.00 Å R-free 0.296

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1T2K	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1A02 STRUCTURE OF THE DNA BINDING DOMAINS OF NFAT, FOS AND JUN BOUND TO DNA Deposited 1997-12-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain J 253–308（56 aa） Fragment：JUN	Mutation：C279S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；THE COMPLEX WAS CRYSTALLIZED IN 300-400 MM AMMONIUM ACETATE SALT, PH 7.5 (10 MM)., VAPOR DIFFUSION, HANGING DROP	Resolution 2.70 Å R-free 0.303
1JNM Crystal Structure of the Jun/CRE Complex Deposited 2001-07-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 254–315（62 aa） Fragment：bZIP domain Chain B 254–315（62 aa） Fragment：bZIP domain	Mutation：C269S Mutation：C269S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；PEG 4000, Cacodylate, sodium chloride, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.286
1JUN NMR STUDY OF C-JUN HOMODIMER Deposited 1995-12-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–44（43 aa） Fragment：LEUCINE ZIPPER DOMAIN, RESIDUES 272 - 315 Chain B 2–44（43 aa） Fragment：LEUCINE ZIPPER DOMAIN, RESIDUES 272 - 315	Mutation：INS(272-275), INS(315) Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：INS(272-275), INS(315) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 3.6；310 K	Resolution not provided
1S9K Crystal Structure of Human NFAT1 and Fos-Jun on the IL-2 ARRE1 Site Deposited 2004-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain E 257–308（52 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；300-400 mM Ammonium Acetate Salt, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 3.10 Å R-free 0.275
5T01 Human c-Jun DNA binding domain homodimer in complex with methylated DNA Deposited 2016-08-15	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 254–315（62 aa） Fragment：DNA binding domain (UNP residues 254-315) Chain B 254–315（62 aa） Fragment：DNA binding domain (UNP residues 254-315)	Mutation：C269S Mutation：C269S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；289 K；0.05 M Citric acid 0.05 M Bis-Tris propane 16% PEG3350	Resolution 1.89 Å R-free 0.227

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	JUN_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–62； UniProt 254–314

Cyclic-AMP-dependent transcription factor ATF-2

Homo sapiens

UniProt P15336

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 4 DNA 2 PDB declaration: hexameric（6） Consistent with all polymer counts	Chain D； UniProt 336–396	Fragment：bZip domain Mutation：C351S	31-MER × 1 31-MER × 1 Interferon regulatory factor 3 × 2 （Q14653） Transcription factor AP-1 × 1 （P05412）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；100 mM NaCacodylate, pH 6.5, 12.5% (w/v) PEG 6000, 400 mM NH4OAc, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.00 Å R-free 0.296

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1T2K	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BHI STRUCTURE OF TRANSACTIVATION DOMAIN OF CRE-BP1/ATF-2, NMR, 20 STRUCTURES Deposited 1998-06-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–38（38 aa） Fragment：ZINC FINGER-LIKE SUBDOMAIN OF THE TRANSACTIVATION DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；300 K	Resolution not provided
4H36 Crystal Structure of JNK3 in Complex with ATF2 Peptide Deposited 2012-09-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 48–55（8 aa） Fragment：UNP residues 48-55	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；294 K；0.2 M sodium chloride, 0.1 M Bis-Tris, 28-31% PEG3350, pH 5.5, VAPOR DIFFUSION, temperature 294K	Resolution 3.00 Å R-free 0.269
6ZQS Crystal structure of double-phosphorylated p38alpha with ATF2(83-102) Deposited 2020-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 83–102（20 aa）	Mutation：S90N	3FF 2-[(2,4-difluorophenyl)amino]-7-{[(2R)-2,3-dihydroxypropyl]oxy}-10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；14% PEG 3350, 0.1 M cacodylate ph 6.5	Resolution 1.95 Å R-free 0.223
6ZR5 Crystal structure of JNK1 in complex with ATF2(19-58) Deposited 2020-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 20–58（39 aa）	Mutation：Q34R, H47R	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；277 K；10% PEG 20000, 20% PEG MME550, 0.03M MgCl2, 0.03M CaCl2, 0.1 M bicine/Trizma base, pH 8.8	Resolution 2.70 Å R-free 0.256
6ZR5 Crystal structure of JNK1 in complex with ATF2(19-58) Deposited 2020-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 20–58（39 aa）	Mutation：Q34R, H47R	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；277 K；10% PEG 20000, 20% PEG MME550, 0.03M MgCl2, 0.03M CaCl2, 0.1 M bicine/Trizma base, pH 8.8	Resolution 2.70 Å R-free 0.256
8YPE The crystal structure of inactive p38 complexed with a ATF2 from 46 to 80 Deposited 2024-03-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 46–80（35 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；20% PEG 3350, 0.2M sodium citrate	Resolution 1.95 Å R-free 0.225
8YPF The crystal structure of inactive p38 complexed with a ATF2 from 46 to 90 Deposited 2024-03-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 46–90（45 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；25% PEG1500, 0.1 M MMT buffer (DL-malic acid, MES monohydrate and Tris base, molar ratios 1:2:2) pH 7.0	Resolution 2.00 Å R-free 0.218
9Y0R Importin alpha 2 in complex with ATF2 basic region Deposited 2025-08-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 352–378（27 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；sodium citrate 0.7 M, 0.1 M HEPES, 10 mM DTT, pH 7	Resolution 2.20 Å R-free 0.222

7 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATF2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–61； UniProt 336–396

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1t2k
Deposition date deposition_date	2004-04-21
Structure title title	Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA
Keywords keywords	PROTEIN DNA COMPLEX, transcription, Transcription-DNA COMPLEX; Transcription/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	31.19 Å
Radius of gyration Rg (electron density) rg_electron	31.56 Å
Forward intensity I(0) i0	81212500.00
Molecular weight molecular_weight	58139.0 kDa
Excluded volume excluded_volume	67291 Å³
Envelope volume envelope_volume	99130 Å³
Hydration-shell volume shell_volume	28674 Å³
Envelope diameter envelope_diameter	119.8 Å
Shell Rg shell_rg	34.87 Å
Envelope Rg envelope_rg	32.19 Å
Shape Rg shape_rg	31.52 Å
Total Rg total_rg	31.91 Å
Total atoms total_atoms	4026
Residues n_residues	403
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	113.5 Å
Rg (real space) rg_real	31.54 Å
Rg uncertainty (real space) rg_real_error	1.15 Å
I(0) (real space) i0_real	8.1210e+07
I(0) uncertainty (real space) i0_real_error	1.2970e+06
Rg (reciprocal space) rg_reciprocal	31.40 Å
I(0) (reciprocal space) i0_reciprocal	81200000.0000
Solution quality estimate total_estimate	0.8049
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	28.9 Å
Skewness Skewness skewness	0.568
Kurtosis Kurtosis kurtosis	-0.202
Angular range angular_range	— – 0.2550 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6770000.0000
Real-space data points n_real_points	52
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.677; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.484; Smooth: 0.945

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	31-MER
Molecular weight formula_weight	9724.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E
Atom count atom_count	4034

TAAATGACATAGGAAAACTGAAAGGGAGAAG

Entity 2 Entity 2 polymer

Description description	31-MER
Molecular weight formula_weight	9336.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F

ACTTCTCCCTTTCAGTTTTCCTATGTCATTT

Entity 3 Entity 3 polymer

Description description	Interferon regulatory factor 3
Molecular weight formula_weight	13058.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Transcription factor AP-1
Molecular weight formula_weight	7314.7 kDa
Mutation mutation	C269S
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MKAERKRMRNRIAASKSRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMN

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 polymer

Description description	Cyclic-AMP-dependent transcription factor ATF-2
Molecular weight formula_weight	7133.3 kDa
Mutation mutation	C351S
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	8

▼

7. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d1t2ka_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.5 — 'Winged helix' DNA-binding domain
Family Family family	a.4.5.23 — Interferon regulatory factor

Domain ID domain_id	d1t2kb_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.5 — 'Winged helix' DNA-binding domain
Family Family family	a.4.5.23 — Interferon regulatory factor

Domain ID domain_id	d1t2kc1
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.3 — Leucine zipper domain
Family Family family	h.1.3.1 — Leucine zipper domain

Domain ID domain_id	d1t2kc2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1t2kd_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.3 — Leucine zipper domain
Family Family family	h.1.3.1 — Leucine zipper domain

CATH v4.4 (4 domains)

Domain ID domain_id	1t2kA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	1t2kB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	1t2kC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	1t2kD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	170 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	186.380 Å
Unit-cell length b length_b	65.210 Å
Unit-cell length c length_c	83.850 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.44 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	29.980 Å
R factor r_factor	0.2570
R_work r_work	0.2570
R_free r_free	0.2960

fit	/app/data/saxs_computation/t2/1t2k/1t2k.fit
pddf	/app/data/pr_computation/t2/1t2k/1t2k.pr.out
profile	/app/data/saxs_computation/t2/1t2k/1t2k.dat

Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interferon regulatory factor 3

State in the Current Structure

Other States of the Same Protein in the Database

Transcription factor AP-1

State in the Current Structure

Other States of the Same Protein in the Database

Cyclic-AMP-dependent transcription factor ATF-2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)