1t5e

The structure of MexA

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Multidrug resistance protein mexA

Pseudomonas aeruginosa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 13	GLYCEROL × 4 D-Glyceraldehyde × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MEXA_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–360； UniProt 24–383 Author chain B； PDBConstruct 1–360； UniProt 24–383 Author chain C； PDBConstruct 1–360； UniProt 24–383 Author chain D； PDBConstruct 1–360； UniProt 24–383 Author chain E； PDBConstruct 1–360； UniProt 24–383 Author chain F； PDBConstruct 1–360； UniProt 24–383 Author chain G； PDBConstruct 1–360； UniProt 24–383 Author chain H； PDBConstruct 1–360； UniProt 24–383 Author chain I； PDBConstruct 1–360； UniProt 24–383 Author chain J； PDBConstruct 1–360； UniProt 24–383 Author chain K； PDBConstruct 1–360； UniProt 24–383 Author chain L； PDBConstruct 1–360； UniProt 24–383 Author chain M； PDBConstruct 1–360； UniProt 24–383

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1t5e
Deposition date deposition_date	2004-05-04
Structure title title	The structure of MexA
Keywords keywords	MexA, antibiotic efflux pump, periplasmic adaptor protein, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1t5e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1t5e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1t5e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	66.67 Å
Rg (electron density)	67.60 Å
Total Rg	67.37 Å
Atom count	23101
Residues	3003
Excluded volume	408300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1t5e__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Multidrug resistance protein mexA
Molecular weight formula_weight	38633.5 kDa
Source method src_method	man
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M
Atom count atom_count	23101

CGKSEAPPPAQTPEVGIVTLEAQTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQLQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNAGDKIITEGLQFVQPGVEVKTVPAKNVASAQKADAAPAKTDSKG

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	D-Glyceraldehyde
Molecular weight formula_weight	90.1 kDa
Source method src_method	syn
Copy count entity_count	9

▼

6. Fold Classification (SCOP + CATH) 52 domains

SCOP 2.08 (13 domains)

Domain ID domain_id	d1t5ea_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5eb_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5ec_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5ed_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5ee_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5ef_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5eg_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5eh_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5ei_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5ej_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5ek_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5el_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

Domain ID domain_id	d1t5em_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.46 — HlyD-like secretion proteins
Superfamily Superfamily superfamily	f.46.1 — HlyD-like secretion proteins
Family Family family	f.46.1.1 — HlyD-like secretion proteins

CATH v4.4 (39 domains)

Domain ID domain_id	1t5eA01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eA02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eA03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eB01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eB02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eB03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eC01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eC02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eC03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eD01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eD02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eD03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eE01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eE02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eE03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eF01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eF02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eF03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eG01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eG02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eG03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eH01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eH02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eH03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eI01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eI02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eI03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eJ01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eJ02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eJ03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eK01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eK02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eK03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eL01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eL02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eL03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

Domain ID domain_id	1t5eM01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	170 — Efflux pump adaptor protein, beta barrel domain

Domain ID domain_id	1t5eM02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	1t5eM03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	470 — Helix hairpin bin

▶

Unit-cell length a length_a	130.551 Å
Unit-cell length b length_b	183.585 Å
Unit-cell length c length_c	213.314 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	107.38 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	26

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	95.000 Å
R factor r_factor	0.2738
R_work r_work	0.2732
R_free r_free	0.2846

The structure of MexA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Multidrug resistance protein mexA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1t5e__assembly_1__model_1

1t5e__assembly_1__model_1 | I(q)

1t5e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 52 domains

SCOP 2.08 (13 domains)

CATH v4.4 (39 domains)

7. Citations (1)

The structure of MexA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Multidrug resistance protein mexA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1t5e__assembly_1__model_1

1t5e__assembly_1__model_1 | I(q)

1t5e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 52 domains

SCOP 2.08 (13 domains)

CATH v4.4 (39 domains)

7. Citations (1)