SAXSdb — 2byp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SOLUBLE ACETYLCHOLINE RECEPTOR

APLYSIA CALIFORNICA

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ALPHA-CONOTOXIN IMI × 5 （P50983） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8WSF8_APLCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 7–214； UniProt 18–225 Author chain B； PDBConstruct 7–214； UniProt 18–225 Author chain C； PDBConstruct 7–214； UniProt 18–225 Author chain D； PDBConstruct 7–214； UniProt 18–225 Author chain E； PDBConstruct 7–214； UniProt 18–225

ALPHA-CONOTOXIN IMI

OrganismNot specified

UniProt P50983

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	SOLUBLE ACETYLCHOLINE RECEPTOR × 5 （Q8WSF8） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CA1_CONIM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–12； UniProt 5–16 Author chain G； PDBConstruct 1–12； UniProt 5–16 Author chain H； PDBConstruct 1–12； UniProt 5–16 Author chain I； PDBConstruct 1–12； UniProt 5–16 Author chain J； PDBConstruct 1–12； UniProt 5–16

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2byp
Deposition date deposition_date	2005-08-03
Structure title title	Crystal structure of Aplysia californica AChBP in complex with alpha- conotoxin ImI
Keywords keywords	RECEPTOR, RECEPTOR COMPLEX, NICOTINIC ACETYLCHOLINE RECEPTOR COMPLEX, CONOTOXIN; RECEPTOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2byp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2byp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2byp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.67 Å
Rg (electron density)	30.96 Å
Total Rg	31.84 Å
Atom count	8879
Residues	1108
Excluded volume	156450 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2byp__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	SOLUBLE ACETYLCHOLINE RECEPTOR
Molecular weight formula_weight	24320.0 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E
Atom count atom_count	10229

DDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR

Source Source

Source organism organism	APLYSIA CALIFORNICA
Common name common_name	CALIFORNIA SEA HARE
NCBI taxonomy ID ncbi_taxonomy_id	6500
Host organism host_organism	HOMO SAPIENS

Entity 2 Entity 2 polymer

Description description	ALPHA-CONOTOXIN IMI
Molecular weight formula_weight	1357.6 kDa
Source method src_method	syn
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G,H,I,J

GCCSDPRCAWRC

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1042

▼

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

Domain ID domain_id	2bypA00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	2bypB00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	2bypC00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	2bypD00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	2bypE00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

▶

Unit-cell length a length_a	130.284 Å
Unit-cell length b length_b	140.036 Å
Unit-cell length c length_c	153.386 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	40

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	2.070 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1740
R_work r_work	0.1730
R_free r_free	0.2140

Crystal structure of Aplysia californica AChBP in complex with alpha- conotoxin ImI

1. Protein Identity and Related Structures Protein Identity & Related Structures

SOLUBLE ACETYLCHOLINE RECEPTOR

State in the Current Structure

Other States of the Same Protein in the Database

ALPHA-CONOTOXIN IMI

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2byp__assembly_1__model_1

2byp__assembly_1__model_1 | I(q)

2byp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

7. Citations (1)

Crystal structure of Aplysia californica AChBP in complex with alpha- conotoxin ImI

1. Protein Identity and Related Structures Protein Identity & Related Structures

SOLUBLE ACETYLCHOLINE RECEPTOR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ALPHA-CONOTOXIN IMI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2byp__assembly_1__model_1

2byp__assembly_1__model_1 | I(q)

2byp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

7. Citations (1)