2h2t

CD23 Lectin domain, Calcium 2+-bound

Method: X-RAY DIFFRACTION D_max: 47.5 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Low affinity immunoglobulin epsilon Fc receptor (Lymphocyte IgE receptor) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (CD23 antigen) ;

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 150–321	Fragment：lectin domain Mutation：H213R, G256S	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；17% (w/v) PEG 4000, 100 mM Mes buffer, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.30 Å R-free 0.200

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2H2T	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1T8C Structure of the C-type lectin domain of CD23 Deposited 2004-05-12	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：derCD23	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；308 K；Ionic strength (raw mmCIF value) 162 mM；Pressure 1 NMR sample composition 25mM Tris, 125mM NaCl, 4mM CaCl2, 0.02% NaN3, 2mM soluble CD23	Resolution not provided
1T8D Structure of the C-type lectin domain of CD23 Deposited 2004-05-12	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：derCD23	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；308 K；Ionic strength (raw mmCIF value) 162 mM；Pressure 1 NMR sample composition 25 mM Tris, 125 mM NaCl, 4 mM CaCl2, 0.02% NaN3, 2 mM [U-100% 13C; U-100% 15N] soluble CD23	Resolution not provided
2H2R Crystal structure of the human CD23 Lectin domain, apo form Deposited 2006-05-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 150–321（172 aa） Fragment：lectin domain Chain B 150–321（172 aa） Fragment：lectin domain	Mutation：H213R, G256S Mutation：H213R, G256S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；293 K；1.2 M sodium monobasic phosphate, 0.8 M potassium dibasic phosphate, 0.1 M Caps buffer pH 10.5, and 0.2 M lithium sulfate; final pH 6.2 , VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.50 Å R-free 0.165
4EZM Crystal structure of the human IgE-Fc(epsilon)3-4 bound to its B cell receptor derCD23 Deposited 2012-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 156–298（143 aa） Fragment：Human derCD23, UNP residues 156-298 Chain H 156–298（143 aa） Fragment：Human derCD23, UNP residues 156-298	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；298 K；3% PEG 8,000, 0.1 M Tris-HCl pH 7.5, VAPOR DIFFUSION, temperature 298K	Resolution 3.10 Å R-free 0.283
4EZM Crystal structure of the human IgE-Fc(epsilon)3-4 bound to its B cell receptor derCD23 Deposited 2012-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain I 156–298（143 aa） Fragment：Human derCD23, UNP residues 156-298 Chain J 156–298（143 aa） Fragment：Human derCD23, UNP residues 156-298	Not recorded	MAN alpha-D-mannopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；298 K；3% PEG 8,000, 0.1 M Tris-HCl pH 7.5, VAPOR DIFFUSION, temperature 298K	Resolution 3.10 Å R-free 0.283
4EZM Crystal structure of the human IgE-Fc(epsilon)3-4 bound to its B cell receptor derCD23 Deposited 2012-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain K 156–298（143 aa） Fragment：Human derCD23, UNP residues 156-298 Chain L 156–298（143 aa） Fragment：Human derCD23, UNP residues 156-298	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；298 K；3% PEG 8,000, 0.1 M Tris-HCl pH 7.5, VAPOR DIFFUSION, temperature 298K	Resolution 3.10 Å R-free 0.283
4G96 Crystal structure of calcium2+-free wild-type CD23 lectin domain Deposited 2012-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.25 Å R-free 0.236
4G96 Crystal structure of calcium2+-free wild-type CD23 lectin domain Deposited 2012-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	SO4 SULFATE ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.25 Å R-free 0.236
4G96 Crystal structure of calcium2+-free wild-type CD23 lectin domain Deposited 2012-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.25 Å R-free 0.236
4G96 Crystal structure of calcium2+-free wild-type CD23 lectin domain Deposited 2012-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.25 Å R-free 0.236
4G9A Crystal structure of calcium2+-bound wild-type CD23 lectin domain Deposited 2012-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	GOL GLYCEROL × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.205
4G9A Crystal structure of calcium2+-bound wild-type CD23 lectin domain Deposited 2012-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	GOL GLYCEROL × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.205
4G9A Crystal structure of calcium2+-bound wild-type CD23 lectin domain Deposited 2012-07-23	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.205
4G9A Crystal structure of calcium2+-bound wild-type CD23 lectin domain Deposited 2012-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	GOL GLYCEROL × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.205
4GI0 Crystal structure of CD23 lectin domain mutant E249A Deposited 2012-08-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 156–298（143 aa） Fragment：UNP residues 156-298 Chain B 156–298（143 aa） Fragment：UNP residues 156-298 Chain C 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：E249A Mutation：E249A Mutation：E249A	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291 K；0.2M potassium thiocyanate, 0.1M bis tris propane pH 8.5, 20% PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.27 Å R-free 0.251
4GJ0 Crystal structure of CD23 lectin domain mutant S252A Deposited 2012-08-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.95 Å R-free 0.212
4GJ0 Crystal structure of CD23 lectin domain mutant S252A Deposited 2012-08-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.95 Å R-free 0.212
4GJ0 Crystal structure of CD23 lectin domain mutant S252A Deposited 2012-08-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.95 Å R-free 0.212
4GJ0 Crystal structure of CD23 lectin domain mutant S252A Deposited 2012-08-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；291 K；18.5% PEG 6000, 2% 1,6-hexanediol, 0.05M ammonium sulphate, 0.1M sodium acetate pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.95 Å R-free 0.212
4GJX Crystal structure of CD23 lectin domain mutant D258A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D258A	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；18% ethanol, 4% PEG 400, 0.1 M sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.80 Å R-free 0.251
4GJX Crystal structure of CD23 lectin domain mutant D258A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D258A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；18% ethanol, 4% PEG 400, 0.1 M sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.80 Å R-free 0.251
4GJX Crystal structure of CD23 lectin domain mutant D258A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D258A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；18% ethanol, 4% PEG 400, 0.1 M sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.80 Å R-free 0.251
4GJX Crystal structure of CD23 lectin domain mutant D258A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D258A	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；18% ethanol, 4% PEG 400, 0.1 M sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.80 Å R-free 0.251
4GJX Crystal structure of CD23 lectin domain mutant D258A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D258A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；18% ethanol, 4% PEG 400, 0.1 M sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.80 Å R-free 0.251
4GJX Crystal structure of CD23 lectin domain mutant D258A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D258A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；18% ethanol, 4% PEG 400, 0.1 M sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.80 Å R-free 0.251
4GJX Crystal structure of CD23 lectin domain mutant D258A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D258A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；18% ethanol, 4% PEG 400, 0.1 M sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.80 Å R-free 0.251
4GJX Crystal structure of CD23 lectin domain mutant D258A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D258A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；291 K；18% ethanol, 4% PEG 400, 0.1 M sodium acetate pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.80 Å R-free 0.251
4GK1 Crystal structure of CD23 lectin domain mutant D270A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D270A	GOL GLYCEROL × 2 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291 K；30% PEG 4000, 0.3M ammonium sulphate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.24 Å R-free 0.226
4GK1 Crystal structure of CD23 lectin domain mutant D270A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D270A	GOL GLYCEROL × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291 K；30% PEG 4000, 0.3M ammonium sulphate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.24 Å R-free 0.226
4GK1 Crystal structure of CD23 lectin domain mutant D270A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D270A	GOL GLYCEROL × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291 K；30% PEG 4000, 0.3M ammonium sulphate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.24 Å R-free 0.226
4GK1 Crystal structure of CD23 lectin domain mutant D270A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D270A	GOL GLYCEROL × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291 K；30% PEG 4000, 0.3M ammonium sulphate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.24 Å R-free 0.226
4GK1 Crystal structure of CD23 lectin domain mutant D270A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D270A	GOL GLYCEROL × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291 K；30% PEG 4000, 0.3M ammonium sulphate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.24 Å R-free 0.226
4GK1 Crystal structure of CD23 lectin domain mutant D270A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D270A	GOL GLYCEROL × 3 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291 K；30% PEG 4000, 0.3M ammonium sulphate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.24 Å R-free 0.226
4GK1 Crystal structure of CD23 lectin domain mutant D270A Deposited 2012-08-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 156–298（143 aa） Fragment：UNP residues 156-298	Mutation：D270A	GOL GLYCEROL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291 K；30% PEG 4000, 0.3M ammonium sulphate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.24 Å R-free 0.226
4GKO Crystal structure of the calcium2+-bound human IgE-Fc(epsilon)3-4 bound to its B cell receptor derCD23 Deposited 2012-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 156–298（143 aa） Fragment：UNP residues 156-298 Chain H 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291 K；0.2 M sodium acetate trihydrate, 0.1 M Tris pH 8.5, 16% PEG 4000, 10 mM CaCl2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 3.30 Å R-free 0.312
4GKO Crystal structure of the calcium2+-bound human IgE-Fc(epsilon)3-4 bound to its B cell receptor derCD23 Deposited 2012-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain I 156–298（143 aa） Fragment：UNP residues 156-298 Chain J 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	MAN alpha-D-mannopyranose × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291 K；0.2 M sodium acetate trihydrate, 0.1 M Tris pH 8.5, 16% PEG 4000, 10 mM CaCl2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 3.30 Å R-free 0.312
4GKO Crystal structure of the calcium2+-bound human IgE-Fc(epsilon)3-4 bound to its B cell receptor derCD23 Deposited 2012-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain K 156–298（143 aa） Fragment：UNP residues 156-298 Chain L 156–298（143 aa） Fragment：UNP residues 156-298	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291 K；0.2 M sodium acetate trihydrate, 0.1 M Tris pH 8.5, 16% PEG 4000, 10 mM CaCl2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 3.30 Å R-free 0.312
4J6J Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form A) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；298 K；16 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.7 , VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.217
4J6J Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form A) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；298 K；16 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.7 , VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.217
4J6J Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form A) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；298 K；16 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.7 , VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.217
4J6J Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form A) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；298 K；16 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.7 , VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.217
4J6K Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form B) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；18 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.218
4J6K Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form B) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；18 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.218
4J6K Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form B) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；18 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.218
4J6K Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form B) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；18 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.218
4J6K Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form B) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；18 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.218
4J6K Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form B) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；18 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.218
4J6K Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form B) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；18 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.218
4J6K Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form B) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；18 % (w/v) PEG 6,000, 2 % (v/v) 1,6-hexanediol, 0.05 M ammonium sulfate and 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.218
4J6L Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form C) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；25 % (w/v) PEG 4,000, 0.15 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.15 Å R-free 0.253
4J6L Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form C) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；25 % (w/v) PEG 4,000, 0.15 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.15 Å R-free 0.253
4J6L Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form C) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；25 % (w/v) PEG 4,000, 0.15 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.15 Å R-free 0.253
4J6L Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form C) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；25 % (w/v) PEG 4,000, 0.15 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.15 Å R-free 0.253
4J6L Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form C) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；25 % (w/v) PEG 4,000, 0.15 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.15 Å R-free 0.253
4J6L Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form C) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；25 % (w/v) PEG 4,000, 0.15 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.15 Å R-free 0.253
4J6L Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form C) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；25 % (w/v) PEG 4,000, 0.15 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.15 Å R-free 0.253
4J6L Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form C) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；25 % (w/v) PEG 4,000, 0.15 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.15 Å R-free 0.253
4J6M Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form D) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；22.5 % (w/v) PEG 3,350, 0.2 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.48 Å R-free 0.243
4J6M Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form D) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；22.5 % (w/v) PEG 3,350, 0.2 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.48 Å R-free 0.243
4J6M Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form D) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；22.5 % (w/v) PEG 3,350, 0.2 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.48 Å R-free 0.243
4J6M Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form D) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；22.5 % (w/v) PEG 3,350, 0.2 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.48 Å R-free 0.243
4J6M Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form D) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；22.5 % (w/v) PEG 3,350, 0.2 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.48 Å R-free 0.243
4J6M Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form D) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；22.5 % (w/v) PEG 3,350, 0.2 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.48 Å R-free 0.243
4J6M Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form D) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；22.5 % (w/v) PEG 3,350, 0.2 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.48 Å R-free 0.243
4J6M Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form D) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；22.5 % (w/v) PEG 3,350, 0.2 M ammonium sulfate and 0.1 M MES pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.48 Å R-free 0.243
4J6N Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form E) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.25；298 K；30 % (w/v) PEG 1,500 and 0.1 M Malic acid: MES: Tris (MMT) buffer pH 4.25, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.85 Å R-free 0.317
4J6N Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form E) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.25；298 K；30 % (w/v) PEG 1,500 and 0.1 M Malic acid: MES: Tris (MMT) buffer pH 4.25, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.85 Å R-free 0.317
4J6P Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form F) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.75；298 K；22.5 % (w/v) PEG 4,000 and 0.1 M sodium citrate pH 4.75, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.214
4J6P Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form F) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.75；298 K；22.5 % (w/v) PEG 4,000 and 0.1 M sodium citrate pH 4.75, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.214
4J6P Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form F) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.75；298 K；22.5 % (w/v) PEG 4,000 and 0.1 M sodium citrate pH 4.75, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.214
4J6P Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form F) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.75；298 K；22.5 % (w/v) PEG 4,000 and 0.1 M sodium citrate pH 4.75, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.214
4J6Q Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form G) Deposited 2013-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；3.7 M NaCl and 0.1 M citric acid pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.54 Å R-free 0.239
4J6Q Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form G) Deposited 2013-02-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 156–298（143 aa） Fragment：Soluble head domain of the B-cell receptor CD23 (UNP Residues 156-298)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；3.7 M NaCl and 0.1 M citric acid pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.54 Å R-free 0.239
4KI1 Primitive triclinic crystal form of the human IgE-Fc(epsilon)3-4 bound to its B cell receptor derCD23 Deposited 2013-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 156–298（143 aa） Fragment：HUMAN DERCD23, UNP residues 156-298 Chain F 156–298（143 aa） Fragment：HUMAN DERCD23, UNP residues 156-298	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；26 % (w/v) PEG 1,500 and 20 % (v/v) glycerol, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 3.20 Å R-free 0.266
4KI1 Primitive triclinic crystal form of the human IgE-Fc(epsilon)3-4 bound to its B cell receptor derCD23 Deposited 2013-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 156–298（143 aa） Fragment：HUMAN DERCD23, UNP residues 156-298 Chain H 156–298（143 aa） Fragment：HUMAN DERCD23, UNP residues 156-298	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；26 % (w/v) PEG 1,500 and 20 % (v/v) glycerol, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 3.20 Å R-free 0.266
5LGK Crystal structure of the human IgE-Fc bound to its B cell receptor derCD23 Deposited 2016-07-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 165–284（120 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；15% (w/v) PEG 8,000, 0.1 M sodium citrate, 0.05 M ammonium sulfate	Resolution 3.50 Å R-free 0.278
5LGK Crystal structure of the human IgE-Fc bound to its B cell receptor derCD23 Deposited 2016-07-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 165–284（120 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；15% (w/v) PEG 8,000, 0.1 M sodium citrate, 0.05 M ammonium sulfate	Resolution 3.50 Å R-free 0.278
6Y0L Crystal structure of human CD23 lectin domain N225D, K229E, S252N, T251N, R253G, S254G mutant Deposited 2020-02-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa）	Mutation：N225D, K229E, S252N, T251N, R253G, S254G	GOL GLYCEROL × 3 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；2.0M ammonium sulphate, 0.2M sodium chloride, 0.1M sodium-cacodylate, 8mM CaCl2	Resolution 1.65 Å R-free 0.205
6Y0M Crystal structure of human CD23 lectin domain N225D, K229E, S252N, T251N mutant Deposited 2020-02-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 156–298（143 aa）	Mutation：N225D, K229E, S252N, T251N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；291 K；0.1M sodium-cacodylate pH 6.5, 1M tri-sodium-citrate Crystals were soaked with a solution of 0.1M sodium-cacodylate at pH 7.1, 1.4M tri-sodium-citrate and 10mM CaCl2 for four days before harvesting which also served as a cryoprotectant.	Resolution 1.50 Å R-free 0.212

22 other PDB entries and 79 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FCER2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 4–175； UniProt 150–321

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2h2t
Deposition date deposition_date	2006-05-19
Structure title title	CD23 Lectin domain, Calcium 2+-bound
Keywords keywords	C-type lectin, calcium-bound, lectin domain, low affinity IgE receptor, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.85 Å
Radius of gyration Rg (electron density) rg_electron	13.58 Å
Forward intensity I(0) i0	4456220.00
Molecular weight molecular_weight	14311.0 kDa
Excluded volume excluded_volume	17527 Å³
Envelope volume envelope_volume	19345 Å³
Hydration-shell volume shell_volume	12033 Å³
Envelope diameter envelope_diameter	46.2 Å
Shell Rg shell_rg	19.45 Å
Envelope Rg envelope_rg	14.02 Å
Shape Rg shape_rg	13.53 Å
Total Rg total_rg	14.85 Å
Total atoms total_atoms	1002
Residues n_residues	124
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	47.5 Å
Rg (real space) rg_real	14.76 Å
Rg uncertainty (real space) rg_real_error	0.21 Å
I(0) (real space) i0_real	4.4560e+06
I(0) uncertainty (real space) i0_real_error	4.6350e+04
Rg (reciprocal space) rg_reciprocal	14.76 Å
I(0) (reciprocal space) i0_reciprocal	4456000.0000
Solution quality estimate total_estimate	0.7378
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	19.2 Å
Skewness Skewness skewness	0.181
Kurtosis Kurtosis kurtosis	-0.291
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	877200.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.843; Stabil: 1.000; Sysdev: 0.368; Positv: 1.000; Valcen: 0.997; Smooth: 0.956

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	;Low affinity immunoglobulin epsilon Fc receptor (Lymphocyte IgE receptor) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (CD23 antigen) ;
Molecular weight formula_weight	19515.7 kDa
Mutation mutation	H213R, G256S
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	1177

SPGMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKRASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQSEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	157

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2h2tb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

CATH v4.4 (1 domains)

Domain ID domain_id	2h2tB01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

▶

8. Citations (1)

▶

Unit-cell length a length_a	40.310 Å
Unit-cell length b length_b	51.261 Å
Unit-cell length c length_c	58.768 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.300 Å
Low-resolution limit resolution_low	38.630 Å
R factor r_factor	0.1695
R_work r_work	0.1678
R_free r_free	0.2004

fit	/app/data/saxs_computation/h2/2h2t/2h2t.fit
pddf	/app/data/pr_computation/h2/2h2t/2h2t.pr.out
profile	/app/data/saxs_computation/h2/2h2t/2h2t.dat