2jf1

CRYSTAL STRUCTURE OF THE FILAMIN A REPEAT 21 COMPLEXED WITH THE INTEGRIN BETA2 CYTOPLASMIC TAIL PEPTIDE

Method: X-RAY DIFFRACTION D_max: 47.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

FILAMIN-A

HOMO SAPIENS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 2236–2329	Fragment：IG 21, RESIDUES 2236-2329	INTEGRIN BETA-2 SUBUNIT × 3 （P05107） GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.6；1.6-1.58 M AMMONIUM SULPHATE, 0.1 M NA-ACETATE PH 4.6	Resolution 2.20 Å R-free 0.278

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2JF1	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2AAV Solution NMR structure of Filamin A domain 17 Deposited 2005-07-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1862–1955（94 aa） Fragment：Filamin A domain 17	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.7；293 K；Ionic strength (raw mmCIF value) 50mM；Pressure 1 NMR sample composition GAMV(1863-1956FLNA), U-13C, U-15N, NMR sample 0.3mM; 50mM sodium phosphate, 10mM dithiothreitol; 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2BP3 Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex Deposited 2005-04-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1863–1956（94 aa） Fragment：ROD DOMAIN, RESIDUES 1863-1956	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；1.75M AMMONIUM PHOSPHATE, PH 8.2, AFTER MICROSEEDING: 1.25M AMMONIUM SULFATE PH 8.2	Resolution 2.32 Å R-free 0.256
2BP3 Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex Deposited 2005-04-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1863–1956（94 aa） Fragment：ROD DOMAIN, RESIDUES 1863-1956	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；1.75M AMMONIUM PHOSPHATE, PH 8.2, AFTER MICROSEEDING: 1.25M AMMONIUM SULFATE PH 8.2	Resolution 2.32 Å R-free 0.256
2BRQ Crystal structure of the filamin A repeat 21 complexed with the integrin beta7 cytoplasmic tail peptide Deposited 2005-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2236–2329（94 aa） Fragment：ROD DOMAIN, RESIDUES 2236-2329 Chain B 2236–2329（94 aa） Fragment：ROD DOMAIN, RESIDUES 2236-2329	Not recorded	GSH Glutathione × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；1.26 M SODIUM CITRATE, 0.1 M CITRIC ACID PH 5.5	Resolution 2.10 Å R-free 0.243
2J3S Crystal structure of the human filamin A Ig domains 19 to 21 Deposited 2006-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2045–2329（285 aa） Fragment：IMMUNOGLOBULIN-LIKE DOMAINS 19 TO 21, RESIDUES 2045-2329	Not recorded	BR BROMIDE ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.1；PROTEIN WAS CRYSTALLIZED FROM 1.6M AMMONIUM SULPHATE, 0.1M CITRIC ACID PH 6.1, 10% DIOXANE.	Resolution 2.50 Å R-free 0.297
2J3S Crystal structure of the human filamin A Ig domains 19 to 21 Deposited 2006-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2045–2329（285 aa） Fragment：IMMUNOGLOBULIN-LIKE DOMAINS 19 TO 21, RESIDUES 2045-2329	Not recorded	BR BROMIDE ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.1；PROTEIN WAS CRYSTALLIZED FROM 1.6M AMMONIUM SULPHATE, 0.1M CITRIC ACID PH 6.1, 10% DIOXANE.	Resolution 2.50 Å R-free 0.297
2K3T Solution Structure of IG-Like Domain 23 from Human Filamin A Deposited 2008-05-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2427–2522（96 aa） Fragment：Ig-like domain 23 of Filamin A (UNP residues 2427-2522)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；298 K；Ionic strength (raw mmCIF value) 150；Pressure ambient NMR sample composition 1 mM [U-13C; U-15N] FLNA23, 20 mM Sodium phosphate, 150 mM Sodium chloride, 1 mM DTT, 2 mM Sodium azide, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2K7P Filamin A Ig-like domains 16-17 Deposited 2008-08-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1772–1956（185 aa） Fragment：Filamin 16-17, UNP residues 1772-1956	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；303 K；Ionic strength (raw mmCIF value) 100；Pressure ambient NMR sample composition 1mM [U-13C; U-15N] FLNa16-17, 50mM sodium phosphate, 100mM potassium chloride, 1mM DTT, 2mM sodium azide, 2mM EDTA, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2K7Q Filamin A Ig-like domains 18-19 Deposited 2008-08-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1954–2141（188 aa） Fragment：Filamin 18-19, UNP residues 1954-2141	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；303 K；Ionic strength (raw mmCIF value) 100；Pressure ambient NMR sample composition 0.8mM [U-13C; U-15N] FLNa18-19, 50mM sodium phosphate, 100mM potassium chloride, 1mM DTT, 2mM sodium azide, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2MTP The structure of Filamin repeat 21 bound to integrin Deposited 2014-08-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2236–2330（95 aa） Fragment：UNP residues 2236-2330	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.4；298 K；Ionic strength (raw mmCIF value) 25；Pressure ambient NMR sample composition 1 mM [U-100% 13C; U-100% 15N; U-80% 2H] protein, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2W0P Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide Deposited 2008-08-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2236–2329（94 aa） Fragment：IG-21, RESIDUES 2236-2329 Chain B 2236–2329（94 aa） Fragment：IG-21, RESIDUES 2236-2329	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions 1.7M (NH4)2SO4, 5% 2-PROPANOL	Resolution 1.90 Å R-free 0.239
2WFN Filamin A actin binding domain Deposited 2009-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–278（278 aa） Fragment：ACTIN BINDING DOMAIN, RESIDUES 1-278 Chain B 1–278（278 aa） Fragment：ACTIN BINDING DOMAIN, RESIDUES 1-278	Not recorded	SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions 1.7 M LITHIUM SULFATE, 0.1 M HEPES PH 7.5	Resolution 3.20 Å R-free 0.243
3CNK Crystal Structure of the dimerization domain of human filamin A Deposited 2008-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2559–2647（89 aa） Fragment：Filamin 24, repeat 24 Chain B 2559–2647（89 aa） Fragment：Filamin 24, repeat 24	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；293 K；0.1M Tris, 30% PEG 3350, 0.2M Lithium Sulfate, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 8.20	Resolution 1.65 Å R-free 0.219
3HOC Structure of the actin-binding domain of human filamin A mutant E254K Deposited 2009-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–269（268 aa） Fragment：Actin-binding domain	Mutation：E254K	PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.263
3HOC Structure of the actin-binding domain of human filamin A mutant E254K Deposited 2009-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–269（268 aa） Fragment：Actin-binding domain	Mutation：E254K	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.263
3HOC Structure of the actin-binding domain of human filamin A mutant E254K Deposited 2009-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–269（268 aa） Fragment：Actin-binding domain Chain B 2–269（268 aa） Fragment：Actin-binding domain	Mutation：E254K Mutation：E254K	PO4 PHOSPHATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.263
3HOP Structure of the actin-binding domain of human filamin A Deposited 2009-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–269（268 aa） Fragment：Actin-binding domain	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.288
3HOP Structure of the actin-binding domain of human filamin A Deposited 2009-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–269（268 aa） Fragment：Actin-binding domain	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.288
3HOR Structure of the actin-binding domain of human filamin A (reduced) Deposited 2009-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–269（268 aa） Fragment：Actin-binding domain	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.294
3HOR Structure of the actin-binding domain of human filamin A (reduced) Deposited 2009-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–269（268 aa） Fragment：Actin-binding domain	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.294
3ISW Crystal structure of filamin-A immunoglobulin-like repeat 21 bound to an N-terminal peptide of CFTR Deposited 2009-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2236–2329（94 aa） Fragment：UNP residues 2236-2329 Chain B 2236–2329（94 aa） Fragment：UNP residues 2236-2329	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1M Bis-Tris Propane pH 7.0, 60% Tacsimate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.80 Å R-free 0.298
3RGH Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens Deposited 2011-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1158–1252（95 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.2 M ammonium acetate, 25%(w/v) PEG 3350, 0.1 M Bis-tris, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.44 Å R-free 0.279
3RGH Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens Deposited 2011-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1158–1252（95 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.2 M ammonium acetate, 25%(w/v) PEG 3350, 0.1 M Bis-tris, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.44 Å R-free 0.279
4M9P Crystal structure of the human filamin A Ig-like domains 3-5 Deposited 2013-08-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 478–766（289 aa） Fragment：domains 3-5 (UNP residues 478-766)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；298 K；0.1 M sodium malonate, 12% w/v PEG3350, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.72 Å R-free 0.243
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	SO4 SULFATE ION × 1 PR PRASEODYMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	SO4 SULFATE ION × 1 PR PRASEODYMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	SO4 SULFATE ION × 1 PR PRASEODYMIUM ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	PR PRASEODYMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	SO4 SULFATE ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
5XR1 Structure of FLN IG21 domain in complex with C-terminal peptide of beta-2 Deposited 2017-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2228–2321（94 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.2；298 K；Ionic strength (raw mmCIF value) 150；Pressure 1 NMR sample composition 300 uM [U-13C; U-15N] FLN IG21 domain, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6D8C Cryo-EM structure of FLNaABD E254K bound to phalloidin-stabilized F-actin Deposited 2018-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain A 1–278（278 aa） Fragment：UNP residues 1-278 Chain B 1–278（278 aa） Fragment：UNP residues 1-278 Chain C 1–278（278 aa） Fragment：UNP residues 1-278 Chain D 1–278（278 aa） Fragment：UNP residues 1-278 Chain E 1–278（278 aa） Fragment：UNP residues 1-278	Mutation：E254K Mutation：E254K Mutation：E254K Mutation：E254K Mutation：E254K	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å
6EW1 Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q Deposited 2017-11-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 478–766（289 aa）	Mutation：P637Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.05 M ammonium citrate, 18 % PEG 3350	Resolution 2.31 Å R-free 0.273
7SC4 filamin complex-1 Deposited 2021-09-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；2 M Ammonium Sulfate, 5% 2-propanol	Resolution 1.85 Å R-free 0.261
7SC4 filamin complex-1 Deposited 2021-09-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2236–2329（94 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；2 M Ammonium Sulfate, 5% 2-propanol	Resolution 1.85 Å R-free 0.261
7SFT Filamin complex-2 Deposited 2021-10-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2236–2330（95 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.4；298 K；Ionic strength (raw mmCIF value) 61；Pressure 1 NMR sample composition 1 mM [U-100% 13C; U-100% 15N] filamin Ig21, 2 mM Integrin alpha-IIb light chain, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-15N; U-2H] filamin Ig21, 2 mM Integrin alpha-IIb light chain, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 2 mM Integrin alpha-IIb light chain, 0.05 mM GST-filamin-Ig21, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
9LWX Crystal structure of the Filamin A repeat 21 Deposited 2025-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate, pH 6.5, 30% w/ Polyethylene glycol (PEG) 8,000	Resolution 2.29 Å R-free 0.268
9LWX Crystal structure of the Filamin A repeat 21 Deposited 2025-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate, pH 6.5, 30% w/ Polyethylene glycol (PEG) 8,000	Resolution 2.29 Å R-free 0.268
9LWX Crystal structure of the Filamin A repeat 21 Deposited 2025-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate, pH 6.5, 30% w/ Polyethylene glycol (PEG) 8,000	Resolution 2.29 Å R-free 0.268
9LWX Crystal structure of the Filamin A repeat 21 Deposited 2025-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate, pH 6.5, 30% w/ Polyethylene glycol (PEG) 8,000	Resolution 2.29 Å R-free 0.268
9LXG Filamin A repeat 21 in complex with LARP4 Ala269-Asn281 peptide Deposited 2025-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2236–2330（95 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.0 M Lithium sulfate, 0.1 M Sodium citrate pH 5.6, 0.5 M Ammonium sulfate	Resolution 2.46 Å R-free 0.259

25 other PDB entries and 41 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLNA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–97； UniProt 2236–2329

INTEGRIN BETA-2 SUBUNIT

OrganismNot specified

UniProt P05107

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain T； UniProt 735–769	Fragment：RESIDUES 735-769	FILAMIN-A × 3 （P21333） GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.6；1.6-1.58 M AMMONIUM SULPHATE, 0.1 M NA-ACETATE PH 4.6	Resolution 2.20 Å R-free 0.278

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 2JF1	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1L3Y INTEGRIN EGF-LIKE MODULE 3 FROM THE BETA-2 SUBUNIT Deposited 2002-03-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 535–574（40 aa） Fragment：RESIDUES 535-574	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.2；298 K；Ionic strength (raw mmCIF value) 5mM NaPO4；Pressure ambient NMR sample composition 1 mM I-EGF3 U-15N, 5 mM NaPO4 \| 90% H2O/10% D2O NMR sample composition 1 mM I-EGF3, 5 mM NaPO4 \| 100% D2O	Resolution not provided
1YUK The crystal structure of the PSI/Hybrid domain/ I-EGF1 segment from the human integrin beta2 at 1.8 resolution Deposited 2005-02-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 23–125（103 aa） Fragment：PSI domain Chain B 365–482（118 aa） Fragment：I-EGF domain	Not recorded	NDG 2-acetamido-2-deoxy-alpha-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；18% PEG 8000, 0.2M calcium acetate, 0.1M Sodium cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.253
2P26 Structure of the PHE2 and PHE3 fragments of the integrin beta2 subunit Deposited 2007-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–122（100 aa） Fragment：PHE2 and PHE3 Chain A 362–535（174 aa） Fragment：PHE2 and PHE3	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.2M Magnesium acetate, 0.1M sodium acetate, pH4.6, 18% PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.75 Å R-free 0.253
2P28 Structure of the PHE2 and PHE3 fragments of the integrin beta2 subunit Deposited 2007-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 23–122（100 aa） Fragment：PHE2 fragment Chain B 362–574（213 aa） Fragment：PHE3 fragment	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M ammonium sulphate, 15% PEG4000, 5% isopropanol, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.20 Å R-free 0.308
3K6S Structure of integrin alphaXbeta2 ectodomain Deposited 2009-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–700（678 aa） Fragment：residues 23-700	Not recorded	MAN alpha-D-mannopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 4 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；277 K；0.55M tri-sodium citrate, 0.1M imidazole, pH 6.5, EVAPORATION, temperature 277K	Resolution 3.50 Å R-free 0.335
3K6S Structure of integrin alphaXbeta2 ectodomain Deposited 2009-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；277 K；0.55M tri-sodium citrate, 0.1M imidazole, pH 6.5, EVAPORATION, temperature 277K	Resolution 3.50 Å R-free 0.335
3K6S Structure of integrin alphaXbeta2 ectodomain Deposited 2009-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；277 K；0.55M tri-sodium citrate, 0.1M imidazole, pH 6.5, EVAPORATION, temperature 277K	Resolution 3.50 Å R-free 0.335
3K6S Structure of integrin alphaXbeta2 ectodomain Deposited 2009-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；277 K；0.55M tri-sodium citrate, 0.1M imidazole, pH 6.5, EVAPORATION, temperature 277K	Resolution 3.50 Å R-free 0.335
3K6S Structure of integrin alphaXbeta2 ectodomain Deposited 2009-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 23–700（678 aa） Fragment：residues 23-700 Chain D 23–700（678 aa） Fragment：residues 23-700 Chain F 23–700（678 aa） Fragment：residues 23-700 Chain H 23–700（678 aa） Fragment：residues 23-700	Not recorded	MAN alpha-D-mannopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 CA CALCIUM ION × 16 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；277 K；0.55M tri-sodium citrate, 0.1M imidazole, pH 6.5, EVAPORATION, temperature 277K	Resolution 3.50 Å R-free 0.335
3K71 Structure of integrin alphaX beta2 ectodomain Deposited 2009-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.55M tri-sodium citrate, 0.05M MgCl2, 0.1M imidazole, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.95 Å R-free 0.373
3K71 Structure of integrin alphaX beta2 ectodomain Deposited 2009-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.55M tri-sodium citrate, 0.05M MgCl2, 0.1M imidazole, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.95 Å R-free 0.373
3K71 Structure of integrin alphaX beta2 ectodomain Deposited 2009-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.55M tri-sodium citrate, 0.05M MgCl2, 0.1M imidazole, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.95 Å R-free 0.373
3K71 Structure of integrin alphaX beta2 ectodomain Deposited 2009-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 CA CALCIUM ION × 4 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.55M tri-sodium citrate, 0.05M MgCl2, 0.1M imidazole, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.95 Å R-free 0.373
3K71 Structure of integrin alphaX beta2 ectodomain Deposited 2009-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 23–700（678 aa） Fragment：residues 23-700 Chain D 23–700（678 aa） Fragment：residues 23-700 Chain F 23–700（678 aa） Fragment：residues 23-700 Chain H 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15 CA CALCIUM ION × 16 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.55M tri-sodium citrate, 0.05M MgCl2, 0.1M imidazole, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.95 Å R-free 0.373
3K72 Structure of integrin alphaX beta2 Deposited 2009-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；277 K；0.915M sodium/potassium phosphate, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.70 Å R-free 0.335
3K72 Structure of integrin alphaX beta2 Deposited 2009-10-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 CA CALCIUM ION × 4 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；277 K；0.915M sodium/potassium phosphate, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.70 Å R-free 0.335
3K72 Structure of integrin alphaX beta2 Deposited 2009-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 23–700（678 aa） Fragment：residues 23-700 Chain D 23–700（678 aa） Fragment：residues 23-700	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 14 CA CALCIUM ION × 16 MAN alpha-D-mannopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；277 K；0.915M sodium/potassium phosphate, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.70 Å R-free 0.335
4NEH An internal ligand-bound, metastable state of a leukocyte integrin, aXb2 Deposited 2013-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–696（674 aa） Fragment：CD18	Mutation：N190D, N232K, V674C	CA CALCIUM ION × 5 MG MAGNESIUM ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CL CHLORIDE ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；297 K；6% PEG 8000, 0.2 M Mg acetate, 0.1 M Na cacodylate, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 2.75 Å R-free 0.225
4NEN An internal ligand-bound, metastable state of a leukocyte integrin, aXb2 Deposited 2013-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–696（674 aa） Fragment：CD18	Mutation：N190D, N232K and V696C	CA CALCIUM ION × 5 MG MAGNESIUM ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；297 K；6% PEG 8000, 0.2 M Mg acetate, 0.1 M Na cacodylate, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 2.90 Å R-free 0.264
5E6R Structures of leukocyte integrin aLb2: The aI domain, the headpiece, and the pocket for the internal ligand Deposited 2015-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–482（460 aa） Fragment：UNP residues 23-482	Mutation：N232R	MG MAGNESIUM ION × 1 CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M MES pH 6.5, 15% PEG 3350	Resolution 2.90 Å R-free 0.229
5E6S Structures of leukocyte integrin aLB2: The aI domain, the headpiece, and the pocket for the internal ligand Deposited 2015-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–482（460 aa） Fragment：UNP residues 23-482	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；277 K；0.1 M Tris, pH 8, 0.1 M NaCl, and 8% polyethylene glycol (PEG) 20,000	Resolution 2.15 Å R-free 0.234
5E6S Structures of leukocyte integrin aLB2: The aI domain, the headpiece, and the pocket for the internal ligand Deposited 2015-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 23–482（460 aa） Fragment：UNP residues 23-482	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；277 K；0.1 M Tris, pH 8, 0.1 M NaCl, and 8% polyethylene glycol (PEG) 20,000	Resolution 2.15 Å R-free 0.234
5E6S Structures of leukocyte integrin aLB2: The aI domain, the headpiece, and the pocket for the internal ligand Deposited 2015-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 23–482（460 aa） Fragment：UNP residues 23-482	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；277 K；0.1 M Tris, pH 8, 0.1 M NaCl, and 8% polyethylene glycol (PEG) 20,000	Resolution 2.15 Å R-free 0.234
5E6S Structures of leukocyte integrin aLB2: The aI domain, the headpiece, and the pocket for the internal ligand Deposited 2015-10-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 23–482（460 aa） Fragment：UNP residues 23-482 Chain D 23–482（460 aa） Fragment：UNP residues 23-482 Chain F 23–482（460 aa） Fragment：UNP residues 23-482	Not recorded	MG MAGNESIUM ION × 3 CA CALCIUM ION × 15 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；277 K；0.1 M Tris, pH 8, 0.1 M NaCl, and 8% polyethylene glycol (PEG) 20,000	Resolution 2.15 Å R-free 0.234
5E6U Structures of leukocyte integrin aLb2: The aI domain, the headpiece, and the pocket for the internal ligand Deposited 2015-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–482（460 aa） Fragment：UNP residues 23-482	Not recorded	MG MAGNESIUM ION × 2 CA CALCIUM ION × 4 CL CHLORIDE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Mg-formate dehydrate and 15% PEG 3350	Resolution 2.50 Å R-free 0.226
5E6V Re-refinement of the Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin b2 Subunit Deposited 2015-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–125（103 aa） Fragment：UNP residues 23-125, 365-482 Chain A 365–482（118 aa） Fragment：UNP residues 23-125, 365-482	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.229
5E6W Re-refinement of the Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin b2 Subunit Deposited 2015-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–122（100 aa） Fragment：UNP residues 23-122, 362-574 Chain A 362–574（213 aa） Fragment：UNP residues 23-122, 362-574	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
5E6X Re-refinement of the Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin b2 Subunit Deposited 2015-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–122（100 aa） Fragment：UNP residues 23-122 and 362 535 Chain A 362–535（174 aa） Fragment：UNP residues 23-122 and 362 535	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.75 Å R-free 0.245
5ES4 RE-REFINEMENT OF INTEGRIN ALPHAXBETA2 ECTODOMAIN IN THE CLOSED/BENT CONFORMATION Deposited 2015-11-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–696（674 aa） Fragment：UNP residues 23-696	Not recorded	CA CALCIUM ION × 4 MG MAGNESIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.55M TRI-SODIUM CITRATE, 0.1M IMIDAZOLE, PH 6.5, EVAPORATION, TEMPERATURE 277K	Resolution 3.30 Å R-free 0.307
5ES4 RE-REFINEMENT OF INTEGRIN ALPHAXBETA2 ECTODOMAIN IN THE CLOSED/BENT CONFORMATION Deposited 2015-11-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 23–696（674 aa） Fragment：UNP residues 23-696	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.55M TRI-SODIUM CITRATE, 0.1M IMIDAZOLE, PH 6.5, EVAPORATION, TEMPERATURE 277K	Resolution 3.30 Å R-free 0.307
5ES4 RE-REFINEMENT OF INTEGRIN ALPHAXBETA2 ECTODOMAIN IN THE CLOSED/BENT CONFORMATION Deposited 2015-11-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 23–696（674 aa） Fragment：UNP residues 23-696	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.55M TRI-SODIUM CITRATE, 0.1M IMIDAZOLE, PH 6.5, EVAPORATION, TEMPERATURE 277K	Resolution 3.30 Å R-free 0.307
5ES4 RE-REFINEMENT OF INTEGRIN ALPHAXBETA2 ECTODOMAIN IN THE CLOSED/BENT CONFORMATION Deposited 2015-11-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 23–696（674 aa） Fragment：UNP residues 23-696	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.55M TRI-SODIUM CITRATE, 0.1M IMIDAZOLE, PH 6.5, EVAPORATION, TEMPERATURE 277K	Resolution 3.30 Å R-free 0.307
5XR1 Structure of FLN IG21 domain in complex with C-terminal peptide of beta-2 Deposited 2017-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 752–763（12 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.2；298 K；Ionic strength (raw mmCIF value) 150；Pressure 1 NMR sample composition 300 uM [U-13C; U-15N] FLN IG21 domain, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
5ZAZ Solution structure of integrin b2 monomer tranmembrane domain in bicelle Deposited 2018-02-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 689–739（51 aa）	Mutation：C695S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.7；303 K；Ionic strength (raw mmCIF value) 20；Pressure 1 NMR sample composition 0.6 mM [U-13C; U-15N] integrin b2, 20 mM Bis-Tris, 240 mM DHPC, 48 mM POPC, 24 mM POPG, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
9ECL Structure of the human integrin beta2 transmembrane domain Deposited 2024-11-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 696–735（40 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；313.2 K；Ionic strength (raw mmCIF value) 0.025；Pressure 1 NMR sample composition 1.2 mM [U-100% 13C; U-100% 15N; U-80% 2H] alphaX peptide, 350 mM 1,2-dihexanoyl-sn-glycero-3-phosphoholine, 105 mM 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine, 25 mM HEPES, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
9RM9 Cryo-EM structure of alphaM/beta2 headpiece complex without alphaM I-domain - the consensus map from alphaM/beta2:C3d-anti-CR3-Nb headpiece complex Deposited 2025-06-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–482（460 aa）	Not recorded	CA CALCIUM ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 MN MANGANESE (II) ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；0.02 % w/v CHAPS added to sample just before vitrification	Resolution 2.60 Å
9T3Y Cryo-EM structure of alphaM/beta2:C3d-anti-CR3-Nb headpiece complex (HPO2 3D class reconstruction) Deposited 2025-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 23–482（460 aa）	Not recorded	CA CALCIUM ION × 5 MN MANGANESE (II) ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；0.02 % w/v CHAPS added to sample just before vitrification	Resolution 3.44 Å
9T5V Cryo-EM structure of alphaM/beta2:C3d-anti-CR3-Nb headpiece complex (HPO1 3D class reconstruction) Deposited 2025-11-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 23–485（463 aa）	Not recorded	CA CALCIUM ION × 5 MN MANGANESE (II) ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；0.02 % w/v CHAPS added to sample just before vitrification	Resolution 3.06 Å
9T5W Cryo-EM structure of mutant R61H alphaM/beta2 headpiece complex Deposited 2025-11-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–482（460 aa）	Not recorded	CA CALCIUM ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 MN MANGANESE (II) ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；0.02 % w/v CHAPS added to sample just before vitrification	Resolution 2.74 Å
9T5Z Cryo-EM structure of alphaM/beta2:MEM148-Fab headpiece complex (without alphaM I-domain) Deposited 2025-11-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 23–485（463 aa）	Not recorded	CA CALCIUM ION × 5 MN MANGANESE (II) ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

24 other PDB entries and 40 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ITB2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain T； PDBConstruct 1–35； UniProt 735–769

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2jf1
Deposition date deposition_date	2007-01-25
Structure title title	CRYSTAL STRUCTURE OF THE FILAMIN A REPEAT 21 COMPLEXED WITH THE INTEGRIN BETA2 CYTOPLASMIC TAIL PEPTIDE
Keywords keywords	;ACTIN-BINDING, CELL ADHESION, TRANSMEMBRANE, ACETYLATION, POLYMORPHISM, CYTOSKELETON, GLYCOPROTEIN, FILAMIN, COMPLEX, MEMBRANE, INTEGRIN, RECEPTOR, PYRROLIDONE CARBOXYLIC ACID, PHOSPHORYLATION, DISEASE MUTATION, IMMUNOGLOBULIN LIKE ;; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.23 Å
Radius of gyration Rg (electron density) rg_electron	12.94 Å
Forward intensity I(0) i0	2235640.00
Molecular weight molecular_weight	10244.0 kDa
Excluded volume excluded_volume	12811 Å³
Envelope volume envelope_volume	14560 Å³
Hydration-shell volume shell_volume	9923 Å³
Envelope diameter envelope_diameter	45.8 Å
Shell Rg shell_rg	18.24 Å
Envelope Rg envelope_rg	13.31 Å
Shape Rg shape_rg	12.93 Å
Total Rg total_rg	14.22 Å
Total atoms total_atoms	723
Residues n_residues	98
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	47.2 Å
Rg (real space) rg_real	14.20 Å
Rg uncertainty (real space) rg_real_error	0.26 Å
I(0) (real space) i0_real	2.2360e+06
I(0) uncertainty (real space) i0_real_error	2.3450e+04
Rg (reciprocal space) rg_reciprocal	14.20 Å
I(0) (reciprocal space) i0_reciprocal	2236000.0000
Solution quality estimate total_estimate	0.8722
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	16.7 Å
Skewness Skewness skewness	0.330
Kurtosis Kurtosis kurtosis	-0.178
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	661600.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.793; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.959

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	FILAMIN-A
Molecular weight formula_weight	9965.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	742

GAMGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS

来源 Source

来源生物 organism	HOMO SAPIENS
通用名 common_name	HUMAN
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	INTEGRIN BETA-2 SUBUNIT
Molecular weight formula_weight	4213.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

YRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	19

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2jf1a_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.10 — Filamin repeat (rod domain)

CATH v4.4 (1 domains)

Domain ID domain_id	2jf1A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	78.720 Å
Unit-cell length b length_b	78.720 Å
Unit-cell length c length_c	78.720 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 3
Space-group number int_tables_number	198
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	45.450 Å
R factor r_factor	0.2500
R_work r_work	0.2470
R_free r_free	0.2780

fit	/app/data/saxs_computation/jf/2jf1/2jf1.fit
pddf	/app/data/pr_computation/jf/2jf1/2jf1.pr.out
profile	/app/data/saxs_computation/jf/2jf1/2jf1.dat

CRYSTAL STRUCTURE OF THE FILAMIN A REPEAT 21 COMPLEXED WITH THE INTEGRIN BETA2 CYTOPLASMIC TAIL PEPTIDE

1. Protein Identity and Related Structures Protein Identity & Related Structures

FILAMIN-A

State in the Current Structure

Other States of the Same Protein in the Database

INTEGRIN BETA-2 SUBUNIT

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)