2bp3

Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex

Method: X-RAY DIFFRACTION D_max: 64.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

FILAMIN A

HOMO SAPIENS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1863–1956	Fragment：ROD DOMAIN, RESIDUES 1863-1956	PLATELET GLYCOPROTEIN IB ALPHA CHAIN × 1 （P07359） GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 8.2；1.75M AMMONIUM PHOSPHATE, PH 8.2, AFTER MICROSEEDING: 1.25M AMMONIUM SULFATE PH 8.2	Resolution 2.32 Å R-free 0.256
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1863–1956	Fragment：ROD DOMAIN, RESIDUES 1863-1956	PLATELET GLYCOPROTEIN IB ALPHA CHAIN × 1 （P07359） GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 8.2；1.75M AMMONIUM PHOSPHATE, PH 8.2, AFTER MICROSEEDING: 1.25M AMMONIUM SULFATE PH 8.2	Resolution 2.32 Å R-free 0.256

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2BP3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2AAV Solution NMR structure of Filamin A domain 17 Deposited 2005-07-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1862–1955（94 aa） Fragment：Filamin A domain 17	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.7；293 K；Ionic strength (raw mmCIF value) 50mM；Pressure 1 NMR sample composition GAMV(1863-1956FLNA), U-13C, U-15N, NMR sample 0.3mM; 50mM sodium phosphate, 10mM dithiothreitol; 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2BRQ Crystal structure of the filamin A repeat 21 complexed with the integrin beta7 cytoplasmic tail peptide Deposited 2005-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2236–2329（94 aa） Fragment：ROD DOMAIN, RESIDUES 2236-2329 Chain B 2236–2329（94 aa） Fragment：ROD DOMAIN, RESIDUES 2236-2329	Not recorded	GSH Glutathione × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；1.26 M SODIUM CITRATE, 0.1 M CITRIC ACID PH 5.5	Resolution 2.10 Å R-free 0.243
2J3S Crystal structure of the human filamin A Ig domains 19 to 21 Deposited 2006-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2045–2329（285 aa） Fragment：IMMUNOGLOBULIN-LIKE DOMAINS 19 TO 21, RESIDUES 2045-2329	Not recorded	BR BROMIDE ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.1；PROTEIN WAS CRYSTALLIZED FROM 1.6M AMMONIUM SULPHATE, 0.1M CITRIC ACID PH 6.1, 10% DIOXANE.	Resolution 2.50 Å R-free 0.297
2J3S Crystal structure of the human filamin A Ig domains 19 to 21 Deposited 2006-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2045–2329（285 aa） Fragment：IMMUNOGLOBULIN-LIKE DOMAINS 19 TO 21, RESIDUES 2045-2329	Not recorded	BR BROMIDE ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.1；PROTEIN WAS CRYSTALLIZED FROM 1.6M AMMONIUM SULPHATE, 0.1M CITRIC ACID PH 6.1, 10% DIOXANE.	Resolution 2.50 Å R-free 0.297
2JF1 CRYSTAL STRUCTURE OF THE FILAMIN A REPEAT 21 COMPLEXED WITH THE INTEGRIN BETA2 CYTOPLASMIC TAIL PEPTIDE Deposited 2007-01-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 2236–2329（94 aa） Fragment：IG 21, RESIDUES 2236-2329	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；1.6-1.58 M AMMONIUM SULPHATE, 0.1 M NA-ACETATE PH 4.6	Resolution 2.20 Å R-free 0.278
2K3T Solution Structure of IG-Like Domain 23 from Human Filamin A Deposited 2008-05-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2427–2522（96 aa） Fragment：Ig-like domain 23 of Filamin A (UNP residues 2427-2522)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；298 K；Ionic strength (raw mmCIF value) 150；Pressure ambient NMR sample composition 1 mM [U-13C; U-15N] FLNA23, 20 mM Sodium phosphate, 150 mM Sodium chloride, 1 mM DTT, 2 mM Sodium azide, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2K7P Filamin A Ig-like domains 16-17 Deposited 2008-08-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1772–1956（185 aa） Fragment：Filamin 16-17, UNP residues 1772-1956	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；303 K；Ionic strength (raw mmCIF value) 100；Pressure ambient NMR sample composition 1mM [U-13C; U-15N] FLNa16-17, 50mM sodium phosphate, 100mM potassium chloride, 1mM DTT, 2mM sodium azide, 2mM EDTA, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2K7Q Filamin A Ig-like domains 18-19 Deposited 2008-08-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1954–2141（188 aa） Fragment：Filamin 18-19, UNP residues 1954-2141	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；303 K；Ionic strength (raw mmCIF value) 100；Pressure ambient NMR sample composition 0.8mM [U-13C; U-15N] FLNa18-19, 50mM sodium phosphate, 100mM potassium chloride, 1mM DTT, 2mM sodium azide, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2MTP The structure of Filamin repeat 21 bound to integrin Deposited 2014-08-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2236–2330（95 aa） Fragment：UNP residues 2236-2330	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.4；298 K；Ionic strength (raw mmCIF value) 25；Pressure ambient NMR sample composition 1 mM [U-100% 13C; U-100% 15N; U-80% 2H] protein, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2W0P Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide Deposited 2008-08-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2236–2329（94 aa） Fragment：IG-21, RESIDUES 2236-2329 Chain B 2236–2329（94 aa） Fragment：IG-21, RESIDUES 2236-2329	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions 1.7M (NH4)2SO4, 5% 2-PROPANOL	Resolution 1.90 Å R-free 0.239
2WFN Filamin A actin binding domain Deposited 2009-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–278（278 aa） Fragment：ACTIN BINDING DOMAIN, RESIDUES 1-278 Chain B 1–278（278 aa） Fragment：ACTIN BINDING DOMAIN, RESIDUES 1-278	Not recorded	SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions 1.7 M LITHIUM SULFATE, 0.1 M HEPES PH 7.5	Resolution 3.20 Å R-free 0.243
3CNK Crystal Structure of the dimerization domain of human filamin A Deposited 2008-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2559–2647（89 aa） Fragment：Filamin 24, repeat 24 Chain B 2559–2647（89 aa） Fragment：Filamin 24, repeat 24	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.2；293 K；0.1M Tris, 30% PEG 3350, 0.2M Lithium Sulfate, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 8.20	Resolution 1.65 Å R-free 0.219
3HOC Structure of the actin-binding domain of human filamin A mutant E254K Deposited 2009-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–269（268 aa） Fragment：Actin-binding domain	Mutation：E254K	PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.263
3HOC Structure of the actin-binding domain of human filamin A mutant E254K Deposited 2009-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–269（268 aa） Fragment：Actin-binding domain	Mutation：E254K	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.263
3HOC Structure of the actin-binding domain of human filamin A mutant E254K Deposited 2009-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–269（268 aa） Fragment：Actin-binding domain Chain B 2–269（268 aa） Fragment：Actin-binding domain	Mutation：E254K Mutation：E254K	PO4 PHOSPHATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.263
3HOP Structure of the actin-binding domain of human filamin A Deposited 2009-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–269（268 aa） Fragment：Actin-binding domain	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.288
3HOP Structure of the actin-binding domain of human filamin A Deposited 2009-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–269（268 aa） Fragment：Actin-binding domain	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.288
3HOR Structure of the actin-binding domain of human filamin A (reduced) Deposited 2009-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–269（268 aa） Fragment：Actin-binding domain	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.294
3HOR Structure of the actin-binding domain of human filamin A (reduced) Deposited 2009-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–269（268 aa） Fragment：Actin-binding domain	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M lithium sulfate, 0.1M Tris HCl, 5mM DTT, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.294
3ISW Crystal structure of filamin-A immunoglobulin-like repeat 21 bound to an N-terminal peptide of CFTR Deposited 2009-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2236–2329（94 aa） Fragment：UNP residues 2236-2329 Chain B 2236–2329（94 aa） Fragment：UNP residues 2236-2329	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1M Bis-Tris Propane pH 7.0, 60% Tacsimate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.80 Å R-free 0.298
3RGH Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens Deposited 2011-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1158–1252（95 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.2 M ammonium acetate, 25%(w/v) PEG 3350, 0.1 M Bis-tris, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.44 Å R-free 0.279
3RGH Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens Deposited 2011-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1158–1252（95 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.2 M ammonium acetate, 25%(w/v) PEG 3350, 0.1 M Bis-tris, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.44 Å R-free 0.279
4M9P Crystal structure of the human filamin A Ig-like domains 3-5 Deposited 2013-08-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 478–766（289 aa） Fragment：domains 3-5 (UNP residues 478-766)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；298 K；0.1 M sodium malonate, 12% w/v PEG3350, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.72 Å R-free 0.243
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	SO4 SULFATE ION × 1 PR PRASEODYMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	SO4 SULFATE ION × 1 PR PRASEODYMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	SO4 SULFATE ION × 1 PR PRASEODYMIUM ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	PR PRASEODYMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
4P3W Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide Deposited 2014-03-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2152–2329（178 aa） Fragment：Filamin repeats 20 and 21, residues 2152-2329	Not recorded	SO4 SULFATE ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；0.1 M MES pH 6, 1.9 M (NH4)2SO4, 0.1 M (CH3CO2)3Pr	Resolution 2.00 Å R-free 0.226
5XR1 Structure of FLN IG21 domain in complex with C-terminal peptide of beta-2 Deposited 2017-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2228–2321（94 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.2；298 K；Ionic strength (raw mmCIF value) 150；Pressure 1 NMR sample composition 300 uM [U-13C; U-15N] FLN IG21 domain, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6D8C Cryo-EM structure of FLNaABD E254K bound to phalloidin-stabilized F-actin Deposited 2018-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain A 1–278（278 aa） Fragment：UNP residues 1-278 Chain B 1–278（278 aa） Fragment：UNP residues 1-278 Chain C 1–278（278 aa） Fragment：UNP residues 1-278 Chain D 1–278（278 aa） Fragment：UNP residues 1-278 Chain E 1–278（278 aa） Fragment：UNP residues 1-278	Mutation：E254K Mutation：E254K Mutation：E254K Mutation：E254K Mutation：E254K	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å
6EW1 Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q Deposited 2017-11-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 478–766（289 aa）	Mutation：P637Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.05 M ammonium citrate, 18 % PEG 3350	Resolution 2.31 Å R-free 0.273
7SC4 filamin complex-1 Deposited 2021-09-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；2 M Ammonium Sulfate, 5% 2-propanol	Resolution 1.85 Å R-free 0.261
7SC4 filamin complex-1 Deposited 2021-09-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2236–2329（94 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；2 M Ammonium Sulfate, 5% 2-propanol	Resolution 1.85 Å R-free 0.261
7SFT Filamin complex-2 Deposited 2021-10-04	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2236–2330（95 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.4；298 K；Ionic strength (raw mmCIF value) 61；Pressure 1 NMR sample composition 1 mM [U-100% 13C; U-100% 15N] filamin Ig21, 2 mM Integrin alpha-IIb light chain, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-15N; U-2H] filamin Ig21, 2 mM Integrin alpha-IIb light chain, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 2 mM Integrin alpha-IIb light chain, 0.05 mM GST-filamin-Ig21, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
9LWX Crystal structure of the Filamin A repeat 21 Deposited 2025-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate, pH 6.5, 30% w/ Polyethylene glycol (PEG) 8,000	Resolution 2.29 Å R-free 0.268
9LWX Crystal structure of the Filamin A repeat 21 Deposited 2025-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate, pH 6.5, 30% w/ Polyethylene glycol (PEG) 8,000	Resolution 2.29 Å R-free 0.268
9LWX Crystal structure of the Filamin A repeat 21 Deposited 2025-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate, pH 6.5, 30% w/ Polyethylene glycol (PEG) 8,000	Resolution 2.29 Å R-free 0.268
9LWX Crystal structure of the Filamin A repeat 21 Deposited 2025-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2236–2329（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate, pH 6.5, 30% w/ Polyethylene glycol (PEG) 8,000	Resolution 2.29 Å R-free 0.268
9LXG Filamin A repeat 21 in complex with LARP4 Ala269-Asn281 peptide Deposited 2025-02-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2236–2330（95 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.0 M Lithium sulfate, 0.1 M Sodium citrate pH 5.6, 0.5 M Ammonium sulfate	Resolution 2.46 Å R-free 0.259

25 other PDB entries and 40 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLNA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–97； UniProt 1863–1956 Author chain B； PDBConstruct 4–97； UniProt 1863–1956

PLATELET GLYCOPROTEIN IB ALPHA CHAIN

OrganismNot specified

UniProt P07359

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain T； UniProt 572–593	Fragment：CYTOPLASMIC DOMAIN, RESIDUES 572-593	FILAMIN A × 1 （P21333） GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 8.2；1.75M AMMONIUM PHOSPHATE, PH 8.2, AFTER MICROSEEDING: 1.25M AMMONIUM SULFATE PH 8.2	Resolution 2.32 Å R-free 0.256
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain S； UniProt 572–593	Fragment：CYTOPLASMIC DOMAIN, RESIDUES 572-593	FILAMIN A × 1 （P21333） GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 8.2；1.75M AMMONIUM PHOSPHATE, PH 8.2, AFTER MICROSEEDING: 1.25M AMMONIUM SULFATE PH 8.2	Resolution 2.32 Å R-free 0.256

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 2BP3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1GWB STRUCTURE OF GLYCOPROTEIN 1B Deposited 2002-03-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 16–296（281 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 16-296	Non-standard monomer：Yes (specific site not provided by mmCIF)	PT PLATINUM (II) ION × 2 ACY ACETIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；pH 6.50	Resolution 2.80 Å R-free 0.274
1GWB STRUCTURE OF GLYCOPROTEIN 1B Deposited 2002-03-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 16–296（281 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 16-296	Non-standard monomer：Yes (specific site not provided by mmCIF)	PT PLATINUM (II) ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；pH 6.50	Resolution 2.80 Å R-free 0.274
1M0Z Crystal Structure of the von Willebrand Factor Binding Domain of Glycoprotein Ib alpha Deposited 2002-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–306（290 aa） Fragment：von Willebrand Factor binding domain	Mutation：N21Q N159Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.2；301 K；ammonium sulfate, lithium sulfate, CAPS, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 301K	Resolution 1.85 Å R-free 0.216
1M0Z Crystal Structure of the von Willebrand Factor Binding Domain of Glycoprotein Ib alpha Deposited 2002-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 17–306（290 aa） Fragment：von Willebrand Factor binding domain	Mutation：N21Q N159Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.2；301 K；ammonium sulfate, lithium sulfate, CAPS, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 301K	Resolution 1.85 Å R-free 0.216
1M10 Crystal structure of the complex of Glycoprotein Ib alpha and the von Willebrand Factor A1 Domain Deposited 2002-06-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 17–306（290 aa） Fragment：von Willebrand Factor binding domain	Mutation：N21Q N159Q M239V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；PEG 3000, sodium chloride, MES, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.10 Å R-free 0.296
1OOK Crystal Structure of the Complex of Platelet Receptor GPIb-alpha and Human alpha-Thrombin Deposited 2003-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 17–306（290 aa） Fragment：N-terminal domain	Mutation：C65A Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG 6000, Ammonium Phosphate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K	Resolution 2.30 Å R-free 0.260
1P8V CRYSTAL STRUCTURE OF THE COMPLEX OF PLATELET RECEPTOR GPIB-ALPHA AND ALPHA-THROMBIN AT 2.6A Deposited 2003-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 17–294（278 aa） Fragment：Glycoprotein 1B alpha	Mutation：N21D Non-standard monomer：Yes (specific site not provided by mmCIF)	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 DFP DIISOPROPYL PHOSPHONATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；291 K；14% PEG 400, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K, pH 6.00	Resolution 2.60 Å R-free 0.238
1P9A Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha at 1.7 Angstrom Resolution Deposited 2003-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain G 17–306（290 aa） Fragment：N-Terminal Domain	Mutation：C65A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；PEG 6000, Sodium Nitrate, Sodium Acetate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.70 Å R-free 0.224
1QYY Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha at 2.8 Angstrom Resolution Deposited 2003-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–306（290 aa） Fragment：N-Terminal Domain	Mutation：C65A	PT PLATINUM (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；PEG 6000, SODIUM NITRATE, SODIUM ACETATE, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.282
1QYY Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha at 2.8 Angstrom Resolution Deposited 2003-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 17–306（290 aa） Fragment：N-Terminal Domain	Mutation：C65A	PT PLATINUM (II) ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；PEG 6000, SODIUM NITRATE, SODIUM ACETATE, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.282
1SQ0 Crystal Structure of the Complex of the Wild-type Von Willebrand Factor A1 domain and Glycoprotein Ib alpha at 2.6 Angstrom Resolution Deposited 2004-03-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 17–304（288 aa） Fragment：Glycoprotein Ib-(alpha)	Mutation：N21D, N159D	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；PEG-3350; potassium thiocyanate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.60 Å R-free 0.239
1U0N The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex Deposited 2004-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 17–281（265 aa） Fragment：Alpha chain	Mutation：N21Q,N159Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；Sodium citrate, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.95 Å R-free 0.276
3P72 structure of platelet Glycoprotein 1b alpha with a bound peptide inhibitor Deposited 2010-10-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 17–281（265 aa） Fragment：UNP residues 17-281	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.2；298 K；1.9M ammonium sulfate, 80mM lithium sulfate, 100mM N-cyclohexyl-3-aminopropanesulfonic acid buffer. 1:1 mix buffer with 4mg/mL protein. lyophilised peptide added directly to crystallised protein drops., pH 8.2, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.90 Å R-free 0.286
3PMH Mechanism of Sulfotyrosine-Mediated Glycoprotein Ib Interaction with Two Distinct alpha-Thrombin Sites Deposited 2010-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 17–306（290 aa） Fragment：unp residues 17-306	Mutation：C65A Non-standard monomer：Yes (specific site not provided by mmCIF)	0G7 D-phenylalanyl-N-[(3S)-6-carbamimidamido-1-chloro-2-oxohexan-3-yl]-L-prolinamide × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；277 K；16% PEG 6000, 0.2M ammonium phosphate, pH 7.0, VAPOR DIFFUSION, temperature 277K	Resolution 3.20 Å R-free 0.263
4C2A Crystal Structure of High-Affinity von Willebrand Factor A1 domain with R1306Q and I1309V Mutations in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 17–306（290 aa） Fragment：RESIDUES 17-306	Mutation：YES	CAC CACODYLATE ION × 1 ACT ACETATE ION × 1 CA CALCIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；CRYSTALS OF A1/VWD2-GPIBALPA/VWD2 COMPLEX APPEARED IN 12% PEG 8000, 0.1 M SODIUM CACODYLATE PH 6.5, 0.1 M CALCIUM ACETATE, AND 0.4 MG/ML RISTOCETIN (SIGMA-ALDRICH). THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING. CRYSTALS GREW IN 10 MG/ML COMPLEX, 14% PEG8000, 0.2 M CALCIUM ACETATE, 0.1 M SODIUM CACODYLATE, PH 6.5, AND 0.4 MG/ML RISTOCETIN. NEXT WE SOAKED THESE CRYSTALS IN 14% PEG8000, 0.2 M CALCIUM ACETATE, 0.1 SODIUM CACODYLATE, PH 6.5, AND 4 MG/ML RISTOCETIN.	Resolution 2.08 Å R-free 0.189
4C2B Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 17–306（290 aa）	Mutation：YES	SO4 SULFATE ION × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS-GPIB/VWD2 COMPLEX APPEARED IN DROPS WITH 20% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING CRYSTAL GROWTH IN 8 MG/ML COMPLEX, 15% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08 M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. SINCE THESE CRYSTALS WERE FORMED IN BUFFER CONTAINING 20% GLYCEROL, NO ADDITIONAL CRYOPROTECTION WAS USED.	Resolution 2.80 Å R-free 0.286
4C2B Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 17–306（290 aa）	Mutation：YES	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS-GPIB/VWD2 COMPLEX APPEARED IN DROPS WITH 20% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING CRYSTAL GROWTH IN 8 MG/ML COMPLEX, 15% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08 M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. SINCE THESE CRYSTALS WERE FORMED IN BUFFER CONTAINING 20% GLYCEROL, NO ADDITIONAL CRYOPROTECTION WAS USED.	Resolution 2.80 Å R-free 0.286
4C2B Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 17–306（290 aa）	Mutation：YES	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS-GPIB/VWD2 COMPLEX APPEARED IN DROPS WITH 20% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING CRYSTAL GROWTH IN 8 MG/ML COMPLEX, 15% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08 M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. SINCE THESE CRYSTALS WERE FORMED IN BUFFER CONTAINING 20% GLYCEROL, NO ADDITIONAL CRYOPROTECTION WAS USED.	Resolution 2.80 Å R-free 0.286
4C2B Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 17–306（290 aa）	Mutation：YES	SO4 SULFATE ION × 4 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS-GPIB/VWD2 COMPLEX APPEARED IN DROPS WITH 20% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING CRYSTAL GROWTH IN 8 MG/ML COMPLEX, 15% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08 M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. SINCE THESE CRYSTALS WERE FORMED IN BUFFER CONTAINING 20% GLYCEROL, NO ADDITIONAL CRYOPROTECTION WAS USED.	Resolution 2.80 Å R-free 0.286
4CH2 Low-salt crystal structure of a thrombin-GpIbalpha peptide complex Deposited 2013-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 287–300（14 aa） Fragment：C-TERMINAL FRAGMENT OF GPIBALPHA, 271-284	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 2 0G6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-prolinamide × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；50 MM SODIUM FORMATE, 16% PEG-3350, pH 7.4	Resolution 1.60 Å R-free 0.187
4CH2 Low-salt crystal structure of a thrombin-GpIbalpha peptide complex Deposited 2013-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Q 287–300（14 aa） Fragment：C-TERMINAL FRAGMENT OF GPIBALPHA, 271-284	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 2 0G6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-prolinamide × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；50 MM SODIUM FORMATE, 16% PEG-3350, pH 7.4	Resolution 1.60 Å R-free 0.187
4CH8 High-salt crystal structure of a thrombin-GpIbalpha peptide complex Deposited 2013-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 287–300（14 aa） Fragment：C-TERMINAL FRAGMENT OF GPIBALPHA, RESIDUES 271-284	Non-standard monomer：Yes (specific site not provided by mmCIF)	NA SODIUM ION × 1 0G6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-prolinamide × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；100 MM SODIUM FORMATE, 18% PEG-3350, pH 7.4	Resolution 1.75 Å R-free 0.242
4CH8 High-salt crystal structure of a thrombin-GpIbalpha peptide complex Deposited 2013-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Q 287–300（14 aa） Fragment：C-TERMINAL FRAGMENT OF GPIBALPHA, RESIDUES 271-284	Non-standard monomer：Yes (specific site not provided by mmCIF)	NA SODIUM ION × 1 0G6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-prolinamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；100 MM SODIUM FORMATE, 18% PEG-3350, pH 7.4	Resolution 1.75 Å R-free 0.242
4CH8 High-salt crystal structure of a thrombin-GpIbalpha peptide complex Deposited 2013-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 287–300（14 aa） Fragment：C-TERMINAL FRAGMENT OF GPIBALPHA, RESIDUES 271-284	Non-standard monomer：Yes (specific site not provided by mmCIF)	NA SODIUM ION × 1 0G6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-prolinamide × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；100 MM SODIUM FORMATE, 18% PEG-3350, pH 7.4	Resolution 1.75 Å R-free 0.242
4CH8 High-salt crystal structure of a thrombin-GpIbalpha peptide complex Deposited 2013-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain S 287–300（14 aa） Fragment：C-TERMINAL FRAGMENT OF GPIBALPHA, RESIDUES 271-284	Non-standard monomer：Yes (specific site not provided by mmCIF)	NA SODIUM ION × 1 0G6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-prolinamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；100 MM SODIUM FORMATE, 18% PEG-3350, pH 7.4	Resolution 1.75 Å R-free 0.242
4MGX Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex Deposited 2013-08-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 577–585（9 aa） Fragment：cytoplasmic domain (UNP residues 577-585)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；297 K；0.1 M HEPES, pH 7.5, 20% w/v PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 3.16 Å R-free 0.277
6XFQ Structure of a novel antithrombotic agent Agkisacucetin in complex with the platelet glycoprotein Ib receptor Deposited 2020-06-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 17–321（305 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；15% PEG4000, 0.1M HEPES, pH 7.5	Resolution 3.30 Å R-free 0.311
8WE2 14-3-3 zeta complexed with S609 phosphorylated peptide derived from GPIb alpha cytoplasmic domain Deposited 2023-09-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain Q 646–652（7 aa） Chain R 646–652（7 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2M Sodium Acetate, 20% PEG 3350	Resolution 2.11 Å R-free 0.238
8WF6 14-3-3 zeta complexed with S559 phosphorylated peptide derived from GPIb alpha cytoplasmic domain Deposited 2023-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain Q 596–607（12 aa） Chain R 596–607（12 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；2% Tacsimate pH7.0, 0.1M Hepes pH7.5, 20% PEG 3350	Resolution 2.47 Å R-free 0.238
8WF6 14-3-3 zeta complexed with S559 phosphorylated peptide derived from GPIb alpha cytoplasmic domain Deposited 2023-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 596–607（12 aa） Chain F 596–607（12 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	SIN SUCCINIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；2% Tacsimate pH7.0, 0.1M Hepes pH7.5, 20% PEG 3350	Resolution 2.47 Å R-free 0.238
8WFS Cryo-EM structure of GPIb-IX Complex Deposited 2023-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain a 523–652（130 aa）	Mutation：S559E, S609E	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.36 Å

20 other PDB entries and 31 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GP1BA_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain S； PDBConstruct 1–22； UniProt 572–593 Author chain T； PDBConstruct 1–22； UniProt 572–593

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2bp3
Deposition date deposition_date	2005-04-18
Structure title title	Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
Keywords keywords	STRUCTURAL PROTEIN, CYTOSKELETON-COMPLEX, ACTIN BINDING PROTEIN, CYTOSKELETON, COMPLEX; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	19.95 Å
Radius of gyration Rg (electron density) rg_electron	19.11 Å
Forward intensity I(0) i0	9230690.00
Molecular weight molecular_weight	22200.0 kDa
Excluded volume excluded_volume	27672 Å³
Envelope volume envelope_volume	33836 Å³
Hydration-shell volume shell_volume	15524 Å³
Envelope diameter envelope_diameter	65.2 Å
Shell Rg shell_rg	24.18 Å
Envelope Rg envelope_rg	19.21 Å
Shape Rg shape_rg	19.10 Å
Total Rg total_rg	19.95 Å
Total atoms total_atoms	1565
Residues n_residues	213
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	64.3 Å
Rg (real space) rg_real	19.94 Å
Rg uncertainty (real space) rg_real_error	0.47 Å
I(0) (real space) i0_real	9.2310e+06
I(0) uncertainty (real space) i0_real_error	1.1300e+05
Rg (reciprocal space) rg_reciprocal	19.95 Å
I(0) (reciprocal space) i0_reciprocal	9231000.0000
Solution quality estimate total_estimate	0.8199
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	19.9 Å
Skewness Skewness skewness	0.288
Kurtosis Kurtosis kurtosis	-0.495
Angular range angular_range	— – 0.4000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2289000.0000
Real-space data points n_real_points	72
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.900; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.955; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	FILAMIN A
Molecular weight formula_weight	9976.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1593

GAMVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD

来源 Source

来源生物 organism	HOMO SAPIENS
通用名 common_name	HUMAN
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	PLATELET GLYCOPROTEIN IB ALPHA CHAIN
Molecular weight formula_weight	2563.0 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T

LRGSLPTFRSSLFLWVRPNGRV

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	28

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2bp3a1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.10 — Filamin repeat (rod domain)

Domain ID domain_id	d2bp3b_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	2bp3A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2bp3B00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	41.900 Å
Unit-cell length b length_b	62.800 Å
Unit-cell length c length_c	122.800 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.320 Å
Low-resolution limit resolution_low	19.880 Å
R factor r_factor	0.2160
R_work r_work	0.2140
R_free r_free	0.2560

fit	/app/data/saxs_computation/bp/2bp3/2bp3.fit
pddf	/app/data/pr_computation/bp/2bp3/2bp3.pr.out
profile	/app/data/saxs_computation/bp/2bp3/2bp3.dat

Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

FILAMIN A

State in the Current Structure

Other States of the Same Protein in the Database

PLATELET GLYCOPROTEIN IB ALPHA CHAIN

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)