SAXSdb — 2jzn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mannose-specific phosphotransferase enzyme IIA component

Escherichia coli

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 2–134 Chain B； UniProt 2–134 Chain C； UniProt 159–323	Mutation：H10E	No other associated polymer	SOLUTION NMR NMR measurement conditions：pH 6.5；303 K；Ionic strength (raw mmCIF value) 20 mM phosphate；Pressure ambient NMR sample composition：0.5-1 mM see details IIAMan(H10E)+IIBMan, 100% D2O \| 100% D2O NMR sample composition：0.5-1 mM see details IIAMan(H10E)+IIBMan, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2JZN	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1PDO PHOSPHOENOLPYRUVATE-DEPENDENT PHOSPHOTRANSFERASE SYSTEM Deposited 1996-03-08	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–132（132 aa） Fragment：IIA ==MAN== DOMAIN, RESIDUES 2 - 133, OF THE IIAB ==MAN== SUBUNIT PLUS PHE-ALA-GLY AT THE CARBOXY TERMINUS	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；pH 6.8	Resolution 1.70 Å R-free 0.244
1VRC Complex of enzyme IIAmannose and the histidine-containing phosphocarrier protein HPr from escherichia coli nmr, restrained regularized mean structure Deposited 2005-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–132（132 aa） Fragment：EIIA DOMAIN Chain B 1–132（132 aa） Fragment：EIIA DOMAIN	Not recorded	PO3 PHOSPHITE ION × 2	SOLUTION NMR NMR measurement conditions pH 6.5；308 K；Ionic strength (raw mmCIF value) 40 mM SODIUM PHOSPHATE	Resolution not provided
1VSQ Solution NMR structure of the productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system Deposited 2008-01-10	Different mutation/modification Different experimental conditions	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 2–134（133 aa） Chain B 2–134（133 aa） Chain C 159–323（165 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 20 mM phosphate；Pressure ambient NMR sample composition 0.5-1 mM IIAMan(H10E)+IIBMan, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5-1 mM IIAMan(H10E)+IIBMan, 100% D2O \| 100% D2O	Resolution not provided
2JZH structure of IIB domain of the mannose transporter of E. coli Deposited 2008-01-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 154–323（170 aa） Fragment：PTS EIIB type-4 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 20；Pressure ambient NMR sample composition 0.5-1 mM [U-100% 13C; U-100% 15N] protein, sodium phosphate, sodium azide, 100% D2O \| 100% D2O NMR sample composition 0.5-1 mM [U-100% 15N] protein, sodium phosphate, sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2JZO Solution NMR structure of the non-productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system Deposited 2008-01-10	Different construct Different mutation/modification Different experimental conditions	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 2–134（133 aa） Fragment：PTS EIIB type-4 domain Chain B 2–134（133 aa） Fragment：PTS EIIB type-4 domain Chain D 159–323（165 aa） Fragment：PTS EIIA type-4 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 20 mM phosphate；Pressure ambient NMR sample composition 0.5-1 mM IIAMan+IIBMan, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5-1 mM IIAMan+IIBMan, 100% D2O \| 100% D2O	Resolution not provided

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PTNAB_ECOLI
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–133； UniProt 2–134 Author chain B； PDBConstruct 1–133； UniProt 2–134 Author chain C； PDBConstruct 1–165； UniProt 159–323

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2jzn
Deposition date deposition_date	2008-01-10
Structure title title	Solution NMR structure of the productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system
Keywords keywords	;phosphotransferase, sugar transport, transferase, complex (transferase-phosphocarrier, Cytoplasm, Membrane, Phosphoprotein, Phosphotransferase system ;; TRANSFERASE
Experimental Method method	SOLUTION NMR

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	24.25 Å
Radius of gyration Rg (electron density) rg_electron	23.16 Å
Forward intensity I(0) i0	36114600.00
Molecular weight molecular_weight	47142.0 kDa
Excluded volume excluded_volume	59598 Å³
Envelope volume envelope_volume	72895 Å³
Hydration-shell volume shell_volume	26311 Å³
Envelope diameter envelope_diameter	80.0 Å
Shell Rg shell_rg	30.18 Å
Envelope Rg envelope_rg	23.40 Å
Shape Rg shape_rg	23.16 Å
Total Rg total_rg	24.07 Å
Total atoms total_atoms	6705
Residues n_residues	431
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	80.1 Å
Rg (real space) rg_real	24.20 Å
Rg uncertainty (real space) rg_real_error	0.53 Å
I(0) (real space) i0_real	3.6110e+07
I(0) uncertainty (real space) i0_real_error	5.1460e+05
Rg (reciprocal space) rg_reciprocal	24.21 Å
I(0) (reciprocal space) i0_reciprocal	36110000.0000
Solution quality estimate total_estimate	0.8882
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	26.7 Å
Skewness Skewness skewness	0.289
Kurtosis Kurtosis kurtosis	-0.443
Angular range angular_range	— – 0.3250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	15790000.0000
Real-space data points n_real_points	64
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.861; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.985; Smooth: 0.975

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Mannose-specific phosphotransferase enzyme IIA component
Molecular weight formula_weight	14439.4 kDa
EC 编号 ec_number	2.7.1.-
Mutation mutation	H10E
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	6705

TIAIVIGTEGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVETGREGVKALKAKPV

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	562
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Mannose-specific phosphotransferase enzyme IIB component
Molecular weight formula_weight	18332.3 kDa
EC 编号 ec_number	2.7.1.69
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

NDYMVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIELEVRKVSTDPKLKMMDLISKIDK

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	562
宿主生物 host_organism	Escherichia coli

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d2jzna_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.54 — PTS system fructose IIA component-like
Superfamily Superfamily superfamily	c.54.1 — PTS system fructose IIA component-like
Family Family family	c.54.1.1 — EIIA-man component-like

Domain ID domain_id	d2jznb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.54 — PTS system fructose IIA component-like
Superfamily Superfamily superfamily	c.54.1 — PTS system fructose IIA component-like
Family Family family	c.54.1.1 — EIIA-man component-like

Domain ID domain_id	d2jznc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.38 — PTS IIb component
Superfamily Superfamily superfamily	c.38.1 — PTS IIb component
Family Family family	c.38.1.0 — automated matches

CATH v4.4 (3 domains)

Domain ID domain_id	2jznA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	510 — Phosphotransferase system, mannose-type IIA component

Domain ID domain_id	2jznB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	510 — Phosphotransferase system, mannose-type IIA component

Domain ID domain_id	2jznC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	35 — Fructose Permease
Homologous superfamily homologous superfamily	10 — Phosphotransferase system, sorbose subfamily IIB component

▶

8. Citations (1)

▶

fit	/app/data/saxs_computation/jz/2jzn/2jzn.fit
pddf	/app/data/pr_computation/jz/2jzn/2jzn.pr.out
profile	/app/data/saxs_computation/jz/2jzn/2jzn.dat

Solution NMR structure of the productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mannose-specific phosphotransferase enzyme IIA component

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)