SAXSdb — 2kpl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 455–580	Fragment：UNP residues 455-580	Protein E6 × 1 （P03126）	SOLUTION NMR NMR measurement conditions：pH 6.8；295 K；Pressure ambient NMR sample composition：0.2-0.6mM MAGI-1 PDZ1-1, 0.02-0.10mM sodium phosphate-2, 50mM sodium chloride-3, 2mM DTT-4, 0.6-1.8mM E6CT-5, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition：0.2-0.6mM [U-15N] MAGI-1 PDZ1-6, 0.02-0.10mM sodium phosphate-7, 50mM sodium chloride-8, 2mM DTT-9, 0.6-1.8mM E6CT-10, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition：0.2-0.6mM [U-100% 13C; U-100% 15N] MAGI-1 PDZ1-11, 0.02-0.10mM sodium phosphate-12, 50mM sodium chloride-13, 2mM DTT-14, 0.6-1.8mM E6CT-15, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2KPL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1WBP SRPK1 bound to 9mer docking motif peptide Deposited 2004-11-04	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1382–1390（9 aa） Fragment：RESIDUES 1382-1390	Not recorded	ACT ACETATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；100MM SODIUM CITRATE PH5.6, 200MM AMMONIUM ACETATE, 15%PEG3350, 5MM PEPTIDE, 5MM ADP, 10MM MGCL2, pH 7.00	Resolution 2.40 Å R-free 0.247
2KPK MAGI-1 PDZ1 Deposited 2009-10-16	Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 455–580（126 aa） Fragment：UNP residues 455-580	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；295 K；Pressure ambient NMR sample composition 0.2-0.6mM MAGI-1 PDZ1-1, 0.02-0.10mM sodium phosphate-2, 50mM sodium chloride-3, 2mM DTT-4, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.2-0.6mM [U-15N] MAGI-1 PDZ1-5, 0.02-0.10mM sodium phosphate-6, 50mM sodium chloride-7, 2mM DTT-8, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.2-0.6mM [U-100% 13C; U-100% 15N] MAGI-1 PDZ1-9, 0.02-0.10mM sodium phosphate-10, 50mM sodium chloride-11, 2mM DTT-12, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2Q9V Crystal structure of the C890S mutant of the 4th PDZ domain of human membrane associated guanylate kinase Deposited 2007-06-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 839–922（84 aa） Fragment：4th PDZ Domain	Mutation：C890S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；1:2 Protein:Well solution ratio, 20% PEG 3350, 10% Ethylene glycol, 200 mM Sodium acetate, 100 mM BTP pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.00 Å R-free 0.233
2R4H Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase Deposited 2007-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1149–1233（85 aa） Fragment：6th PDZ domain: Residues 1149-1233	Mutation：C1190S	HIS HISTIDINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277 K；20% PEG 3350, 0.1M Citrate pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.05 Å R-free 0.258
2R4H Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase Deposited 2007-08-31	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1149–1233（85 aa） Fragment：6th PDZ domain: Residues 1149-1233	Mutation：C1190S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277 K；20% PEG 3350, 0.1M Citrate pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.05 Å R-free 0.258
2R4H Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase Deposited 2007-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1149–1233（85 aa） Fragment：6th PDZ domain: Residues 1149-1233	Mutation：C1190S	HIS HISTIDINE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277 K；20% PEG 3350, 0.1M Citrate pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.05 Å R-free 0.258
2YSD Solution structure of the first WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1. MAGI-1 Deposited 2007-04-03	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 295–338（44 aa） Fragment：WW domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；296 K；Ionic strength (raw mmCIF value) 120mM；Pressure ambient NMR sample composition 1.2mM sample U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2YSE Solution structure of the second WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1. MAGI-1 Deposited 2007-04-03	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 355–401（47 aa） Fragment：WW domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；296 K；Ionic strength (raw mmCIF value) 120mM；Pressure ambient NMR sample composition 1.0mM sample U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2ZAJ Solution structure of the short-isoform of the second WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI-1) Deposited 2007-10-05	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 355–390（36 aa） Fragment：WW 2 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120mM；Pressure ambient NMR sample composition 0.7mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
3BPU Crystal structure of the 3rd PDZ domain of human membrane associated guanylate kinase, C677S and C709S double mutant Deposited 2007-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 640–721（82 aa） Fragment：3rd PDZ domain: Residues 640-721	Mutation：C677S, C709S	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；0.05M Zn acetate pH 6.2, 30% PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.60 Å R-free 0.251
5N7D MAGI-1 complexed with a RSK1 peptide Deposited 2017-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 455–558（104 aa）	Not recorded	GOL GLYCEROL × 3 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；296 K；8% PEG 400, 100 mM acetate buffer	Resolution 2.30 Å R-free 0.227
5N7D MAGI-1 complexed with a RSK1 peptide Deposited 2017-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 455–558（104 aa）	Not recorded	GOL GLYCEROL × 2 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；296 K；8% PEG 400, 100 mM acetate buffer	Resolution 2.30 Å R-free 0.227
5N7F MAGI-1 complexed with a pRSK1 peptide Deposited 2017-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 454–558（105 aa）	Not recorded	GOL GLYCEROL × 3 CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；296 K；14% PEG 8000, 200 mM MgCl2, 100 mM TRIS	Resolution 2.30 Å R-free 0.240
5N7F MAGI-1 complexed with a pRSK1 peptide Deposited 2017-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 454–558（105 aa）	Not recorded	GOL GLYCEROL × 3 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；296 K；14% PEG 8000, 200 mM MgCl2, 100 mM TRIS	Resolution 2.30 Å R-free 0.240
5N7G MAGI-1 complexed with a synthetic pRSK1 peptide Deposited 2017-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 455–558（104 aa）	Not recorded	GOL GLYCEROL × 3 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；296 K；14% PEG 8000, 200 mM MgCl2, 100 mM TRIS	Resolution 2.95 Å R-free 0.264
5N7G MAGI-1 complexed with a synthetic pRSK1 peptide Deposited 2017-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 455–558（104 aa）	Not recorded	GOL GLYCEROL × 2 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；296 K；14% PEG 8000, 200 mM MgCl2, 100 mM TRIS	Resolution 2.95 Å R-free 0.264
6TWU MAGI1_2 complexed with a phosphomimetic 16E6 peptide Deposited 2020-01-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 458–558（101 aa）	Not recorded	GOL GLYCEROL × 2 CIT CITRIC ACID × 1 CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；22% PEG3000, 100mM Na-citrate (pH5.5), 100mM Na-citrate	Resolution 2.40 Å R-free 0.255
6TWU MAGI1_2 complexed with a phosphomimetic 16E6 peptide Deposited 2020-01-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 458–558（101 aa）	Not recorded	GOL GLYCEROL × 1 CIT CITRIC ACID × 2 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；22% PEG3000, 100mM Na-citrate (pH5.5), 100mM Na-citrate	Resolution 2.40 Å R-free 0.255
6TWX MAGI1_2 complexed with a phosphorylated 16E6 peptide Deposited 2020-01-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 455–558（104 aa）	Not recorded	GOL GLYCEROL × 1 CIT CITRIC ACID × 1 CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；22% PEG3000, 100mM Na-citrate (5.5), 100mM Na-citrate	Resolution 2.30 Å R-free 0.259
6TWX MAGI1_2 complexed with a phosphorylated 16E6 peptide Deposited 2020-01-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 455–558（104 aa）	Not recorded	GOL GLYCEROL × 1 CIT CITRIC ACID × 2 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；22% PEG3000, 100mM Na-citrate (5.5), 100mM Na-citrate	Resolution 2.30 Å R-free 0.259
6TWY MAGI1_2 complexed with a phosphomimetic RSK1 peptide Deposited 2020-01-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 458–558（101 aa）	Not recorded	GOL GLYCEROL × 2 CIT CITRIC ACID × 1 CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；22% PEG3000, 100mM Na-citrate (pH 5.5), 100mM Na-citrate	Resolution 2.30 Å R-free 0.250
6TWY MAGI1_2 complexed with a phosphomimetic RSK1 peptide Deposited 2020-01-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 458–558（101 aa）	Not recorded	GOL GLYCEROL × 1 CIT CITRIC ACID × 2 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；22% PEG3000, 100mM Na-citrate (pH 5.5), 100mM Na-citrate	Resolution 2.30 Å R-free 0.250
7P71 The PDZ domain of MAGI1_2 complexed with the PDZ-binding motif of HPV35-E6 Deposited 2021-07-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 455–558（104 aa）	Not recorded	CA CALCIUM ION × 4 GOL GLYCEROL × 3 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20-25% polyethylene glycol 3000, 100 mM sodium citrate buffered at pH 5.5 and 100 mM trisodium-citrate	Resolution 2.60 Å R-free 0.281
7P71 The PDZ domain of MAGI1_2 complexed with the PDZ-binding motif of HPV35-E6 Deposited 2021-07-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 455–558（104 aa）	Not recorded	CA CALCIUM ION × 4 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20-25% polyethylene glycol 3000, 100 mM sodium citrate buffered at pH 5.5 and 100 mM trisodium-citrate	Resolution 2.60 Å R-free 0.281

15 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MAGI1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–129； UniProt 455–580

Protein E6

Human papillomavirus type 16

UniProt P03126

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 148–157	Not recorded	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 × 1 （Q96QZ7）	SOLUTION NMR NMR measurement conditions：pH 6.8；295 K；Pressure ambient NMR sample composition：0.2-0.6mM MAGI-1 PDZ1-1, 0.02-0.10mM sodium phosphate-2, 50mM sodium chloride-3, 2mM DTT-4, 0.6-1.8mM E6CT-5, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition：0.2-0.6mM [U-15N] MAGI-1 PDZ1-6, 0.02-0.10mM sodium phosphate-7, 50mM sodium chloride-8, 2mM DTT-9, 0.6-1.8mM E6CT-10, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition：0.2-0.6mM [U-100% 13C; U-100% 15N] MAGI-1 PDZ1-11, 0.02-0.10mM sodium phosphate-12, 50mM sodium chloride-13, 2mM DTT-14, 0.6-1.8mM E6CT-15, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2KPL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2FK4 Solution structure of the C-terminal zinc binding domain of the HPV16 E6 oncoprotein Deposited 2006-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 87–158（72 aa） Fragment：C-TERMINAL DOMAIN	Mutation：C4S, C20S, C34S, C63S	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 6.8；288 K；Ionic strength (raw mmCIF value) 50 mM；Pressure ambient NMR measurement conditions pH 6.8；288 K；Ionic strength (raw mmCIF value) 50 mM；Pressure ambient NMR sample composition 1.0 mM E6C U-15N; 20 mM TRIS-HCl, 50 mM NaCl, 1mM DTT \| 90% H2O/10% D2O NMR sample composition 1.0 mM E6C, 20 mM TRIS-HCl, 50 mM NaCl, 1mM DTT \| 90% H2O/10% D2O	Resolution not provided
2LJX Structure of the monomeric N-terminal domain of HPV16 E6 oncoprotein Deposited 2011-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 7–89（83 aa） Fragment：Zinc finger containing residues 7-89	Mutation：F47R, C80S	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 6.8；296 K；Ionic strength (raw mmCIF value) 50 mM；Pressure ambient NMR sample composition 1 mM E6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] E6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 15N] E6, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2LJY Haddock model structure of the N-terminal domain dimer of HPV16 E6 Deposited 2011-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 7–89（83 aa） Fragment：Zinc finger containing residues 7-86 Chain B 7–89（83 aa） Fragment：Zinc finger containing residues 7-86	Mutation：C80S Mutation：C80S	ZN ZINC ION × 2	SOLUTION NMR NMR measurement conditions pH 6.8；296 K；Ionic strength (raw mmCIF value) 50 mM NaCl；Pressure ambient NMR sample composition 0.3 mM E6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.3 mM [U-100% 15N] E6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.3 mM [U-100% 13C; U-100% 15N] E6, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2LJZ Structure of the C-terminal domain of HPV16 E6 oncoprotein Deposited 2011-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 87–158（72 aa） Fragment：Zinc finger containing residues 87-158	Mutation：C80S, C97S, C111S, C140S	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 6.8；286 K；Ionic strength (raw mmCIF value) 50 mM NaCl；Pressure ambient NMR sample composition 1 mM E6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] E6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 15N] E6, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
4GIZ Crystal structure of full-length human papillomavirus oncoprotein E6 in complex with LXXLL peptide of ubiquitin ligase E6AP at 2.55 A resolution Deposited 2012-08-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 9–150（142 aa） Fragment：unp residues 9-150	Mutation：F47R,C80S,C97S,C111S,C140S	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.5；290 K；10% peg8000, pH 9.5, VAPOR DIFFUSION, SITTING DROP, temperature 290K	Resolution 2.55 Å R-free 0.196
4GIZ Crystal structure of full-length human papillomavirus oncoprotein E6 in complex with LXXLL peptide of ubiquitin ligase E6AP at 2.55 A resolution Deposited 2012-08-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 9–150（142 aa） Fragment：unp residues 9-150	Mutation：F47R,C80S,C97S,C111S,C140S	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.5；290 K；10% peg8000, pH 9.5, VAPOR DIFFUSION, SITTING DROP, temperature 290K	Resolution 2.55 Å R-free 0.196
4JOP CFTR Associated Ligand (CAL) PDZ bound to HPV16 E6 oncoprotein C-terminal peptide (TRRETQL) Deposited 2013-03-18	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 152–158（7 aa） Fragment：HPV16 E6 peptide	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；32% (w/v) polyethylene glycol (PEG), 0.125 M sodium chloride, 0.1 M tris(hydroxymethyl)aminomethane (Tris), pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.219
4JOP CFTR Associated Ligand (CAL) PDZ bound to HPV16 E6 oncoprotein C-terminal peptide (TRRETQL) Deposited 2013-03-18	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 152–158（7 aa） Fragment：HPV16 E6 peptide	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；32% (w/v) polyethylene glycol (PEG), 0.125 M sodium chloride, 0.1 M tris(hydroxymethyl)aminomethane (Tris), pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.219
4XR8 Crystal structure of the HPV16 E6/E6AP/p53 ternary complex at 2.25 A resolution Deposited 2015-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 8–158（151 aa）	Mutation：C80S,C97S,C111S,C140S	PEG DI(HYDROXYETHYL)ETHER × 2 ZN ZINC ION × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；290 K；7.5 % PEG 20K, 0.05 M MES pH 6.5	Resolution 2.25 Å R-free 0.246
4XR8 Crystal structure of the HPV16 E6/E6AP/p53 ternary complex at 2.25 A resolution Deposited 2015-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 8–158（151 aa）	Mutation：C80S,C97S,C111S,C140S	PEG DI(HYDROXYETHYL)ETHER × 2 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；290 K；7.5 % PEG 20K, 0.05 M MES pH 6.5	Resolution 2.25 Å R-free 0.246
6HKS Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal peptide Deposited 2018-09-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 148–158（11 aa）	Not recorded	IOD IODIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20% w/v PEG 3350 0.2 mM KI pH 7	Resolution 2.19 Å R-free 0.247
6HKS Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal peptide Deposited 2018-09-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 148–158（11 aa）	Not recorded	IOD IODIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20% w/v PEG 3350 0.2 mM KI pH 7	Resolution 2.19 Å R-free 0.247
6HKS Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal peptide Deposited 2018-09-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 148–158（11 aa）	Not recorded	IOD IODIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20% w/v PEG 3350 0.2 mM KI pH 7	Resolution 2.19 Å R-free 0.247
6HKS Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal peptide Deposited 2018-09-07	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 148–158（11 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20% w/v PEG 3350 0.2 mM KI pH 7	Resolution 2.19 Å R-free 0.247
6HKS Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal peptide Deposited 2018-09-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 148–158（11 aa）	Not recorded	IOD IODIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20% w/v PEG 3350 0.2 mM KI pH 7	Resolution 2.19 Å R-free 0.247
6HKS Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal peptide Deposited 2018-09-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 148–158（11 aa）	Not recorded	IOD IODIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20% w/v PEG 3350 0.2 mM KI pH 7	Resolution 2.19 Å R-free 0.247
6SIV Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif Deposited 2019-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 6–158（153 aa）	Mutation：F1047R,C1080S,C1097S,C1111S,C1140S	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；298 K；PEG 1500 30%	Resolution 1.75 Å R-free 0.220
6SJA Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif Deposited 2019-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 7–158（152 aa）	Mutation：F1047R,C1080S,C1097S,C1111S,C1140S	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.8；298 K；PEG 1500 30%	Resolution 1.50 Å R-free 0.191
6TWU MAGI1_2 complexed with a phosphomimetic 16E6 peptide Deposited 2020-01-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 149–158（10 aa）	Not recorded	GOL GLYCEROL × 1 CIT CITRIC ACID × 2 CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；22% PEG3000, 100mM Na-citrate (pH5.5), 100mM Na-citrate	Resolution 2.40 Å R-free 0.255
7UAJ Crystal structure of apo HPV16 E6 Deposited 2022-03-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 8–158（151 aa） Chain B 8–158（151 aa） Chain C 8–158（151 aa） Chain D 8–158（151 aa）	Not recorded	ZN ZINC ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1 M HEPES, 8% ethylene glycol and 10% PEG 8000 at pH 7.5	Resolution 3.25 Å R-free 0.282
8GCR HPV16 E6-E6AP-p53 complex Deposited 2023-03-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–158（158 aa）	Mutation：C87S,C104S,C118S,C147S	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
8JRN Structure of E6AP-E6 complex in Att1 state Deposited 2023-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–158（158 aa） Chain D 1–158（158 aa）	Mutation：C87S/C104S/C118S/C147S Mutation：C87S/C104S/C118S/C147S	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
8JRO Structure of E6AP-E6 complex in Att2 state Deposited 2023-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–158（158 aa） Chain D 1–158（158 aa）	Mutation：C87S/C104S/C118S/C147S Mutation：C87S/C104S/C118S/C147S	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
8JRP Structure of E6AP-E6 complex in Att3 state Deposited 2023-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 9–149（141 aa） Chain D 9–149（141 aa）	Mutation：C87S/C104S/C118S/C147S Mutation：C87S/C104S/C118S/C147S	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.58 Å
8JRQ Structure of E6AP-E6 complex in Det1 state Deposited 2023-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–158（158 aa） Chain D 1–158（158 aa）	Mutation：C87S/C104S/C118S/C147S Mutation：C87S/C104S/C118S/C147S	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.15 Å
8JRR Structure of E6AP-E6 complex in Det2 state Deposited 2023-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 12–146（135 aa） Chain D 12–146（135 aa）	Mutation：C87S/C104S/C118S Mutation：C87S/C104S/C118S	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.35 Å
8R1F Monomeric E6AP-E6-p53 ternary complex Deposited 2023-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–158（158 aa）	Mutation：C80S,C97S,C111S,C140S	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å
8R1G Dimeric ternary structure of E6AP-E6-p53 Deposited 2023-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–158（158 aa） Chain E 1–158（158 aa）	Mutation：C80S,C97S,C111S,C140S Mutation：C80S,C97S,C111S,C140S	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.99 Å
9CHT Human E3 ligase E6AP in complex with HPV16-E6 and p53 Deposited 2024-07-02	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 8–158（151 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å

21 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VE6_HPV16
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–10； UniProt 148–157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2kpl
Deposition date deposition_date	2009-10-16
Structure title title	MAGI-1 PDZ1 / E6CT
Keywords keywords	;PDZ domain, ATP-binding, Cell junction, Cell membrane, Membrane, Nucleotide-binding, Phosphoprotein, Tight junction, Activator, DNA-binding, Early protein, Host-virus interaction, Metal-binding, Nucleus, Oncogene, Transcription, Transcription regulation, Zinc-finger, PROTEIN BINDING-ONCOPROTEIN complex ;; PROTEIN BINDING/ONCOPROTEIN
Experimental Method method	SOLUTION NMR

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	15.43 Å
Radius of gyration Rg (electron density) rg_electron	15.15 Å
Forward intensity I(0) i0	1291350000.00
Molecular weight molecular_weight	304610.0 kDa
Excluded volume excluded_volume	381810 Å³
Envelope volume envelope_volume	54802 Å³
Hydration-shell volume shell_volume	21926 Å³
Envelope diameter envelope_diameter	71.5 Å
Shell Rg shell_rg	27.98 Å
Envelope Rg envelope_rg	22.11 Å
Shape Rg shape_rg	15.11 Å
Total Rg total_rg	15.58 Å
Total atoms total_atoms	43040
Residues n_residues	2800
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	63.2 Å
Rg (real space) rg_real	15.46 Å
Rg uncertainty (real space) rg_real_error	0.50 Å
I(0) (real space) i0_real	1.2910e+09
I(0) uncertainty (real space) i0_real_error	1.5520e+07
Rg (reciprocal space) rg_reciprocal	15.45 Å
I(0) (reciprocal space) i0_reciprocal	1291000000.0000
Solution quality estimate total_estimate	0.7360
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	18.4 Å
Skewness Skewness skewness	0.551
Kurtosis Kurtosis kurtosis	0.608
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	839900.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.287; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.705; Smooth: 0.999

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
Molecular weight formula_weight	13871.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	43040

GAMGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protein E6
Molecular weight formula_weight	1379.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

RSSRTRRETQV

来源 Source

来源生物 organism	Human papillomavirus type 16
NCBI Class编号 ncbi_taxonomy_id	333760
宿主生物 host_organism	Escherichia coli

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2kpla1
Class class	b — All beta proteins
Fold Fold fold	b.36 — PDZ domain-like
Superfamily Superfamily superfamily	b.36.1 — PDZ domain-like
Family Family family	b.36.1.1 — PDZ domain

Domain ID domain_id	d2kpla2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	2kplA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

▶

8. Citations (1)

▶

fit	/app/data/saxs_computation/kp/2kpl/2kpl.fit
pddf	/app/data/pr_computation/kp/2kpl/2kpl.pr.out
profile	/app/data/saxs_computation/kp/2kpl/2kpl.dat

MAGI-1 PDZ1 / E6CT

1. Protein Identity and Related Structures Protein Identity & Related Structures

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Protein E6

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)