SAXSdb — 5n7f

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Ribosomal protein S6 kinase alpha-1 × 1 （Q15418） GLYCEROL × 3 CALCIUM ION × 5 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	GLYCEROL × 3 CALCIUM ION × 4 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANXA2_HUMAN
Isoform	P07355-2
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 110–427； UniProt 40–357 Author chain B； PDBConstruct 110–427； UniProt 40–357

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2

Homo sapiens

UniProt Q96QZ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Ribosomal protein S6 kinase alpha-1 × 1 （Q15418） GLYCEROL × 3 CALCIUM ION × 5 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	GLYCEROL × 3 CALCIUM ION × 4 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MAGI1_HUMAN
Isoform	Q96QZ7-5
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–107； UniProt 454–558 Author chain B； PDBConstruct 3–107； UniProt 454–558

Ribosomal protein S6 kinase alpha-1

Homo sapiens

UniProt Q15418

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2 × 1 （P07355,Q96QZ7） GLYCEROL × 3 CALCIUM ION × 5 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KS6A1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 2–49； UniProt 688–735

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5n7f
Deposition date deposition_date	2017-02-20
Structure title title	MAGI-1 complexed with a pRSK1 peptide
Keywords keywords	docking, signaling protein, complex; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5n7f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5n7f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5n7f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.71 Å
Rg (electron density)	24.97 Å
Total Rg	25.77 Å
Atom count	3397
Residues	428
Excluded volume	60739 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5n7f__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5n7f__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2
Molecular weight formula_weight	48099.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	7311

GSMGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLGSSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Ribosomal protein S6 kinase alpha-1
Molecular weight formula_weight	5340.1 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GSQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	634

▶

Unit-cell length a length_a	60.150 Å
Unit-cell length b length_b	98.560 Å
Unit-cell length c length_c	200.310 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 2 21 21
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	49.730 Å
R factor r_factor	0.1889
R_work r_work	0.1862
R_free r_free	0.2401

MAGI-1 complexed with a pRSK1 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2

State in the Current Structure

Other States of the Same Protein in the Database

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2

State in the Current Structure

Other States of the Same Protein in the Database

Ribosomal protein S6 kinase alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5n7f__assembly_1__model_1

5n7f__assembly_1__model_1 | I(q)

5n7f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

MAGI-1 complexed with a pRSK1 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1,Annexin A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein S6 kinase alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5n7f__assembly_1__model_1

5n7f__assembly_1__model_1 | I(q)

5n7f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)