2kzt

Structure of the Tandem MA-3 Region of Pdcd4

Method: SOLUTION NMR

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Programmed cell death protein 4

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Programmed cell death protein 4 × 1 （Q61823）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PDCD4_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–163； UniProt 157–318

Programmed cell death protein 4

Mus musculus

UniProt Q61823

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Programmed cell death protein 4 × 1 （Q53EL6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PDCD4_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–131； UniProt 319–449

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2kzt
Deposition date deposition_date	2010-06-24
Structure title title	Structure of the Tandem MA-3 Region of Pdcd4
Keywords keywords	Pdcd4, MA-3, eIF4A, HEAT, Apoptosis; APOPTOSIS
Experimental Method method	SOLUTION NMR

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2kzt__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2kzt__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2kzt__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.66 Å
Rg (electron density)	22.99 Å
Total Rg	23.70 Å
Atom count	2792
Residues	294
Excluded volume	41068 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2kzt__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`2kzt__assembly_1__model_2`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`2kzt__assembly_1__model_3`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`2kzt__assembly_1__model_4`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`2kzt__assembly_1__model_5`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`2kzt__assembly_1__model_6`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`2kzt__assembly_1__model_7`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	8	`2kzt__assembly_1__model_8`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	9	`2kzt__assembly_1__model_9`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	10	`2kzt__assembly_1__model_10`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	11	`2kzt__assembly_1__model_11`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	12	`2kzt__assembly_1__model_12`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	13	`2kzt__assembly_1__model_13`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	14	`2kzt__assembly_1__model_14`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	15	`2kzt__assembly_1__model_15`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	16	`2kzt__assembly_1__model_16`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	17	`2kzt__assembly_1__model_17`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	18	`2kzt__assembly_1__model_18`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	19	`2kzt__assembly_1__model_19`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	20	`2kzt__assembly_1__model_20`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	21	`2kzt__assembly_1__model_21`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	22	`2kzt__assembly_1__model_22`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	23	`2kzt__assembly_1__model_23`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	24	`2kzt__assembly_1__model_24`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	25	`2kzt__assembly_1__model_25`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	26	`2kzt__assembly_1__model_26`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	27	`2kzt__assembly_1__model_27`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	28	`2kzt__assembly_1__model_28`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	29	`2kzt__assembly_1__model_29`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	30	`2kzt__assembly_1__model_30`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	31	`2kzt__assembly_1__model_31`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	32	`2kzt__assembly_1__model_32`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	33	`2kzt__assembly_1__model_33`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	34	`2kzt__assembly_1__model_34`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	35	`2kzt__assembly_1__model_35`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	36	`2kzt__assembly_1__model_36`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	37	`2kzt__assembly_1__model_37`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	38	`2kzt__assembly_1__model_38`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	39	`2kzt__assembly_1__model_39`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	40	`2kzt__assembly_1__model_40`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	41	`2kzt__assembly_1__model_41`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	42	`2kzt__assembly_1__model_42`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	43	`2kzt__assembly_1__model_43`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	44	`2kzt__assembly_1__model_44`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	45	`2kzt__assembly_1__model_45`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	46	`2kzt__assembly_1__model_46`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	47	`2kzt__assembly_1__model_47`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	48	`2kzt__assembly_1__model_48`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	49	`2kzt__assembly_1__model_49`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	50	`2kzt__assembly_1__model_50`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	51	`2kzt__assembly_1__model_51`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	52	`2kzt__assembly_1__model_52`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	53	`2kzt__assembly_1__model_53`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	54	`2kzt__assembly_1__model_54`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	55	`2kzt__assembly_1__model_55`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	56	`2kzt__assembly_1__model_56`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	57	`2kzt__assembly_1__model_57`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	58	`2kzt__assembly_1__model_58`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	59	`2kzt__assembly_1__model_59`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	60	`2kzt__assembly_1__model_60`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	61	`2kzt__assembly_1__model_61`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	62	`2kzt__assembly_1__model_62`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	63	`2kzt__assembly_1__model_63`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	64	`2kzt__assembly_1__model_64`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	65	`2kzt__assembly_1__model_65`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	66	`2kzt__assembly_1__model_66`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	67	`2kzt__assembly_1__model_67`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	68	`2kzt__assembly_1__model_68`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	69	`2kzt__assembly_1__model_69`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	70	`2kzt__assembly_1__model_70`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	71	`2kzt__assembly_1__model_71`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	72	`2kzt__assembly_1__model_72`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	73	`2kzt__assembly_1__model_73`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Programmed cell death protein 4
Molecular weight formula_weight	17653.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	203816

GLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Programmed cell death protein 4
Molecular weight formula_weight	15093.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS

Source Source

Source organism organism	Mus musculus
Common name common_name	mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2kztb_
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.1 — ARM repeat
Family Family family	a.118.1.14 — MIF4G domain-like

CATH v4.4 (2 domains)

Domain ID domain_id	2kztA00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	180 —

Domain ID domain_id	2kztB00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	180 —

▶

Structure of the Tandem MA-3 Region of Pdcd4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Programmed cell death protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Programmed cell death protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2kzt__assembly_1__model_1

2kzt__assembly_1__model_1 | I(q)

2kzt__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)