2o7u

Crystal structure of K206E/K296E mutant of the N-terminal half molecule of human transferrin

Method: X-RAY DIFFRACTION D_max: 148.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serotransferrin

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259
3	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain C； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259
4	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain D； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259
5	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain E； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259
6	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain F； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259
7	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain G； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259
8	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain H； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259
9	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain I； UniProt 20–356	Fragment：N-lobe Mutation：K206E, K296E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Protein: 35mg/ml, 0.1M ammonium bicarbonate. Well: 20% PEG 3350, 0.2 M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.259

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2O7U	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1A8E HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE Deposited 1998-03-24	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–350（329 aa） Fragment：N-TERMINAL LOBE	Not recorded	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.75；277 K；PROTEIN WAS CRYSTALLIZED FROM 26% PEG 4000. BUFFER WAS 40MM NA CACODYLATE, PH 5.75, WITH 20MM NA BICARBONATE. CRYSTALS GROWN AT 4 DEGREES C USING THE HANGING DROP METHOD., vapor diffusion - hanging drop, temperature 277K	Resolution 1.60 Å
1A8F HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE Deposited 1998-03-25	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–350（329 aa） Fragment：N-TERMINAL LOBE	Not recorded	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；PROTEIN WAS CRYSTALLIZED FROM 40% (V/V) ETHANOL WITH 50MM POTASSIUM CACODYLATE, PH 6.1. GROWN IN SITTING DROPS AT 277 K. RESERVOIRS CONTAINED 40% (V/V) ETHANOL, 50MM POTASSIUM CACODYLATE, PH 5.8 - 6.3. PRIOR TO CRYSTALLIZATION, THE PROTEIN WAS DIALYSED AGAINST SODIUM BICARBONATE, PH 8.1, vapor diffusion - sitting drop	Resolution 1.80 Å R-free 0.250
1B3E HUMAN SERUM TRANSFERRIN, N-TERMINAL LOBE, EXPRESSED IN PICHIA PASTORIS Deposited 1998-12-09	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–352（330 aa） Fragment：N-TERMINAL LOBE	Not recorded	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.25；277 K；PROTEIN WAS CRYSTALLIZED FROM 40% (V/V) ETHANOL WITH 50MM SODIUM CACODYLATE, PH 6.25. GROWN IN SITTING DROPS AT 277 K. RESERVOIRS CONTAINED 40% (V/V) ETHANOL, 50MM SODIUM CACODYLATE, PH 5.8 - 6.3. PRIOR TO CRYSTALLIZATION, THE PROTEIN WAS DIALYSED AGAINST SODIUM BICARBONATE, PH 8.1, VAPOR DIFFUSION, SITTING DROP, temperature 277.0K	Resolution 2.50 Å R-free 0.255
1BP5 HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE, APO FORM Deposited 1998-08-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–356（337 aa） Fragment：N-TERMINAL LOBE	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.3；PROTEIN WAS CRYSTALLIZED FROM 35% MPD. BUFFER WAS 50MM POTASSIUM ACETATE, PH 5.3, WITH 50MM KCL, AND 20MM NA BICARBONATE CRYSTALS GROWN AT 4 DEGREES C USING THE SITTING DROP METHOD.	Resolution 2.20 Å R-free 0.292
1BP5 HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE, APO FORM Deposited 1998-08-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20–356（337 aa） Fragment：N-TERMINAL LOBE	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.3；PROTEIN WAS CRYSTALLIZED FROM 35% MPD. BUFFER WAS 50MM POTASSIUM ACETATE, PH 5.3, WITH 50MM KCL, AND 20MM NA BICARBONATE CRYSTALS GROWN AT 4 DEGREES C USING THE SITTING DROP METHOD.	Resolution 2.20 Å R-free 0.292
1BP5 HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE, APO FORM Deposited 1998-08-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 20–356（337 aa） Fragment：N-TERMINAL LOBE	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.3；PROTEIN WAS CRYSTALLIZED FROM 35% MPD. BUFFER WAS 50MM POTASSIUM ACETATE, PH 5.3, WITH 50MM KCL, AND 20MM NA BICARBONATE CRYSTALS GROWN AT 4 DEGREES C USING THE SITTING DROP METHOD.	Resolution 2.20 Å R-free 0.292
1BP5 HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE, APO FORM Deposited 1998-08-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 20–356（337 aa） Fragment：N-TERMINAL LOBE	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.3；PROTEIN WAS CRYSTALLIZED FROM 35% MPD. BUFFER WAS 50MM POTASSIUM ACETATE, PH 5.3, WITH 50MM KCL, AND 20MM NA BICARBONATE CRYSTALS GROWN AT 4 DEGREES C USING THE SITTING DROP METHOD.	Resolution 2.20 Å R-free 0.292
1BTJ HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE, APO FORM, CRYSTAL FORM 2 Deposited 1998-09-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–356（337 aa） Fragment：N-TERMINAL LOBE	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.3；PROTEIN DROP: 20 MG/ML PROTEIN, 20MM NAHCO3, 50 MM KCL. RESERVOIR: 50 MM POTASSIUM ACETATE, PH 5.3, 35% MPD., VAPOR DIFFUSION, SITTING DROP	Resolution 3.20 Å R-free 0.312
1BTJ HUMAN SERUM TRANSFERRIN, RECOMBINANT N-TERMINAL LOBE, APO FORM, CRYSTAL FORM 2 Deposited 1998-09-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20–356（337 aa） Fragment：N-TERMINAL LOBE	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.3；PROTEIN DROP: 20 MG/ML PROTEIN, 20MM NAHCO3, 50 MM KCL. RESERVOIR: 50 MM POTASSIUM ACETATE, PH 5.3, 35% MPD., VAPOR DIFFUSION, SITTING DROP	Resolution 3.20 Å R-free 0.312
1D3K HUMAN SERUM TRANSFERRIN Deposited 1999-09-29	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–350（329 aa） Fragment：N-TERMINAL LOBE	Mutation：K206Q	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.75；277 K；PEG 4000, sodium bicarbonate, sodium cacodylate, pH 5.75, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K	Resolution 1.80 Å R-free 0.225
1D4N HUMAN SERUM TRANSFERRIN Deposited 1999-10-04	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–350（329 aa） Fragment：N-TERMINAL LOBE	Mutation：H207E	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.75；277 K；PEG 4000, SODIUM BICARBONATE, SODIUM CACODYLATE, pH 5.75, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.218
1DTG HUMAN TRANSFERRIN N-LOBE MUTANT H249E Deposited 2000-01-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–353（334 aa） Fragment：N-TERMINAL HALF MOLECULE	Mutation：H249E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；277 K；50 mM cacodylate 40% ethanol, pH 6.1, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.40 Å R-free 0.294
1FQE CRYSTAL STRUCTURES OF MUTANT (K206A) THAT ABOLISH THE DILYSINE INTERACTION IN THE N-LOBE OF HUMAN TRANSFERRIN Deposited 2000-09-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–350（331 aa） Fragment：N-LOBE	Mutation：K206A	FE FE (III) ION × 1 CO3 CARBONATE ION × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293 K；20-25% PolyEthyleneGlycol 3350, 100mM Potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.80 Å R-free 0.237
1FQF CRYSTAL STRUCTURES OF MUTANT (K296A) THAT ABOLISH THE DILYSINE INTERACTION IN THE N-LOBE OF HUMAN TRANSFERRIN Deposited 2000-09-04	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–350（331 aa） Fragment：N-LOBE	Mutation：K296A	FE FE (III) ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293 K；18% PolyEthyleneGlycol 3350, 100mM Potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.10 Å R-free 0.295
1JQF Human Transferrin N-Lobe Mutant H249Q Deposited 2001-08-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–353（334 aa） Fragment：N-TERMINUS (Residues 20-353)	Mutation：H249Q	CO3 CARBONATE ION × 1 FE FE (III) ION × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；Hanging drop. Protein solution 35 mg/ml protein in 0.1M ammonium bicarbonate pH 7.4. Reservoir solution 0.1M potassium acetate, pH 7.4, 20-25% PEG 3350. Equal volumes of protein and reservoir solutions mixed., VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.85 Å R-free 0.246
1N7W Crystal Structure of Human Serum Transferrin, N-Lobe L66W mutant Deposited 2002-11-18	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–350（331 aa） Fragment：N-TERMINAL LOBE	Mutation：L66W	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.7；293 K；0.2M POTASSIUM ACETATE, 20% PEG 3350, pH 7.7, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.237
1N7X HUMAN SERUM TRANSFERRIN, N-LOBE Y45E MUTANT Deposited 2002-11-18	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–350（331 aa） Fragment：N-TERMINAL LOBE	Mutation：Y45E	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.7；293 K；0.2M POTASSIUM ACETATE, 20% PEG 3350, pH 7.7, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.10 Å R-free 0.243
1N84 HUMAN SERUM TRANSFERRIN, N-LOBE Deposited 2002-11-19	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–350（331 aa） Fragment：N-TERMINAL LOBE	Not recorded	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.7；293 K；0.2M POTASSIUM ACETATE, 20% PEG 3350, pH 7.7, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.05 Å R-free 0.228
1OQG Crystal structure of the D63E mutant of the N-lobe human transferrin Deposited 2003-03-09	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–356（337 aa） Fragment：N-lobe	Mutation：D63E	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；PEG 3350, potassium acetate, ammonium bicarbonate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.90 Å R-free 0.261
1OQH Crystal Structure of the R124A mutant of the N-lobe human transferrin Deposited 2003-03-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–356（337 aa） Fragment：N-lobe	Mutation：R124A	CO3 CARBONATE ION × 1 FE FE (III) ION × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；291 K；PEG 3350, potassium acetate, ammonium bicarbonate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.40 Å R-free 0.288
1RYO Human serum transferrin, N-lobe bound with oxalate Deposited 2003-12-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–346（327 aa） Fragment：N-terminal lobe (residues 20-346)	Not recorded	OXL OXALATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.7；293 K；0.2M K-Acetate, 10mM KCl, 20% PEG 3350, pH 7.7, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.20 Å R-free 0.235
1SUV Structure of Human Transferrin Receptor-Transferrin Complex Deposited 2004-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 22–350（329 aa） Fragment：repeat 1 Chain D 22–350（329 aa） Fragment：repeat 1	Not recorded	CO3 CARBONATE ION × 4 FE FE (III) ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4	Resolution 7.50 Å
28MR X-ray structure of the adduct between human serum transferrin with Fe3+ bound at the C-lobe and diruthenium tetraacetate chloride Deposited 2026-02-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 MLI MALONATE ION × 1 GOL GLYCEROL × 1 ACT ACETATE ION × 1 RU RUTHENIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；15% (w/v) PEG 3350, 16% (v/v) glycerol, 8 mM disodium malonate, 150 mM Na-PIPES pH 6.5	Resolution 2.26 Å R-free 0.234
28MS X-ray structure of the adduct between human serum transferrin with Fe3+ bound at the C-lobe and dirhodium tetraacetate Deposited 2026-02-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 MLI MALONATE ION × 1 ACT ACETATE ION × 3 PEG DI(HYDROXYETHYL)ETHER × 2 GOL GLYCEROL × 1 A1JZ3 Rhodium tetraacetate dihydrate × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；15% (w/v) PEG 3350 16% (v/v) glycerol 8 mM disodium malonate 150 mM Na-PIPES pH 6.5	Resolution 2.37 Å R-free 0.244
2HAU Apo-Human Serum Transferrin (Non-Glycosylated) Deposited 2006-06-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–698（676 aa）	Mutation：N413D,N611D Non-standard monomer：Yes (specific site not provided by mmCIF)	CIT CITRIC ACID × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；15 mg/ml protein, 0.3 M ammonium citrate, 16-18% PEG 3350 , pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 2.70 Å R-free 0.324
2HAU Apo-Human Serum Transferrin (Non-Glycosylated) Deposited 2006-06-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 23–698（676 aa）	Mutation：N413D,N611D Non-standard monomer：Yes (specific site not provided by mmCIF)	CIT CITRIC ACID × 3 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；15 mg/ml protein, 0.3 M ammonium citrate, 16-18% PEG 3350 , pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 2.70 Å R-free 0.324
2HAV Apo-Human Serum Transferrin (Glycosylated) Deposited 2006-06-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–698（676 aa）	Not recorded	CIT CITRIC ACID × 3 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；30 mg/ml protein, 0.2 M ammonium citrate pH 7.0, 20% PEG-3350, 15% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.70 Å R-free 0.293
2HAV Apo-Human Serum Transferrin (Glycosylated) Deposited 2006-06-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 23–698（676 aa）	Not recorded	CIT CITRIC ACID × 4 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；30 mg/ml protein, 0.2 M ammonium citrate pH 7.0, 20% PEG-3350, 15% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.70 Å R-free 0.293
2O84 Crystal structure of K206E mutant of N-lobe human transferrin Deposited 2006-12-12	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 20–356（337 aa） Fragment：N-lobe	Mutation：K206E	FE FE (III) ION × 1 CO3 CARBONATE ION × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293 K；Protein: 35mg/ml, 0.1M ammonium bicrbonate. Well: 18% PEG3350, 0.2M potassium acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.269
3FGS Crystal structure of G65R/K206E double mutant of the N-lobe human transferrin Deposited 2008-12-08	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–356（337 aa） Fragment：Peptidase S60 1 domain	Mutation：G65R, K206E	CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.7；293 K；200 mM potassium acetate buffer (pH 7.7) containing 10 mM KCl and 18% polyethylene glycol 3350. Concentration of the mutant was 17.5 mg/mL. Crystals appeared in approximately a week following micro-seeding with wild-type N-lobe, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.80 Å R-free 0.246
3QYT Diferric bound human serum transferrin Deposited 2011-03-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 2 CO3 CARBONATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；271 K；0.01M HEPES, 15% PEG3000, pH 7.4, vapor diffusion, sitting drop, temperature 271K	Resolution 2.80 Å R-free 0.275
3S9L Complex between transferrin receptor 1 and transferrin with iron in the N-Lobe, cryocooled 2 Deposited 2011-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 20–698（679 aa） Fragment：UNP residues 20-698	Mutation：N427D,Y440F, Y531F N625D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CA CALCIUM ION × 2 FE FE (III) ION × 2 CO3 CARBONATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；5% PEG 3350, 0.2 M MgCl2, 10% 1,2-propanediol, pH Hepes 7.5, vapor diffusion, hanging drop, temperature 293K	Resolution 3.22 Å R-free 0.314
3S9L Complex between transferrin receptor 1 and transferrin with iron in the N-Lobe, cryocooled 2 Deposited 2011-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 20–698（679 aa） Fragment：UNP residues 20-698	Mutation：N427D,Y440F, Y531F N625D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CA CALCIUM ION × 2 FE FE (III) ION × 2 CO3 CARBONATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；5% PEG 3350, 0.2 M MgCl2, 10% 1,2-propanediol, pH Hepes 7.5, vapor diffusion, hanging drop, temperature 293K	Resolution 3.22 Å R-free 0.314
3S9M Complex between transferrin receptor 1 and transferrin with iron in the N-Lobe, cryocooled 1 Deposited 2011-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 20–698（679 aa） Fragment：UNP residues 20-698	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CA CALCIUM ION × 2 CO3 CARBONATE ION × 2 FE FE (III) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；5% PEG 3350, 0.2 M MgCl2, 20% 1,2-propanediol, pH Hepes 7.5, vapor diffusion, hanging drop, temperature 293K	Resolution 3.32 Å R-free 0.332
3S9M Complex between transferrin receptor 1 and transferrin with iron in the N-Lobe, cryocooled 1 Deposited 2011-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 20–698（679 aa） Fragment：UNP residues 20-698	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CA CALCIUM ION × 2 CO3 CARBONATE ION × 2 FE FE (III) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；5% PEG 3350, 0.2 M MgCl2, 20% 1,2-propanediol, pH Hepes 7.5, vapor diffusion, hanging drop, temperature 293K	Resolution 3.32 Å R-free 0.332
3S9N Complex between transferrin receptor 1 and transferrin with iron in the N-Lobe, room temperature Deposited 2011-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 20–698（679 aa） Fragment：UNP residues 20-698	Mutation：N427D, Y531F	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CA CALCIUM ION × 2 FE FE (III) ION × 2 CO3 CARBONATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；5% PEG 3350, 0.2 M MgCl2, 10% 1,2-propanediol, pH Hepes 7.5, vapor diffusion, hanging drop, temperature 293K	Resolution 3.25 Å R-free 0.289
3S9N Complex between transferrin receptor 1 and transferrin with iron in the N-Lobe, room temperature Deposited 2011-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 20–698（679 aa） Fragment：UNP residues 20-698	Mutation：N427D, Y531F	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CA CALCIUM ION × 2 FE FE (III) ION × 2 CO3 CARBONATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；5% PEG 3350, 0.2 M MgCl2, 10% 1,2-propanediol, pH Hepes 7.5, vapor diffusion, hanging drop, temperature 293K	Resolution 3.25 Å R-free 0.289
3SKP The structure of apo-human transferrin C-lobe with bound sulfate ions Deposited 2011-06-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 358–698（341 aa） Fragment：iron binding protein	Not recorded	SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；0.2 M potassium sulfate, 2.2 M ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.70 Å R-free 0.198
3SKP The structure of apo-human transferrin C-lobe with bound sulfate ions Deposited 2011-06-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 358–698（341 aa） Fragment：iron binding protein	Not recorded	SO4 SULFATE ION × 32	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；0.2 M potassium sulfate, 2.2 M ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.70 Å R-free 0.198
3SKP The structure of apo-human transferrin C-lobe with bound sulfate ions Deposited 2011-06-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 358–698（341 aa） Fragment：iron binding protein	Not recorded	SO4 SULFATE ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；0.2 M potassium sulfate, 2.2 M ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.70 Å R-free 0.198
3V83 The 2.1 angstrom crystal structure of diferric human transferrin Deposited 2011-12-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 2 FE FE (III) ION × 2 SO4 SULFATE ION × 5 P6G HEXAETHYLENE GLYCOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100mM HEPES, pH 7.5, 1.6 M ammonium sulfate, and 2% PEG 1000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.230
3V83 The 2.1 angstrom crystal structure of diferric human transferrin Deposited 2011-12-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 2 FE FE (III) ION × 2 SO4 SULFATE ION × 9 P6G HEXAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100mM HEPES, pH 7.5, 1.6 M ammonium sulfate, and 2% PEG 1000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.230
3V83 The 2.1 angstrom crystal structure of diferric human transferrin Deposited 2011-12-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 2 FE FE (III) ION × 2 SO4 SULFATE ION × 7 P6G HEXAETHYLENE GLYCOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100mM HEPES, pH 7.5, 1.6 M ammonium sulfate, and 2% PEG 1000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.230
3V83 The 2.1 angstrom crystal structure of diferric human transferrin Deposited 2011-12-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 2 FE FE (III) ION × 2 SO4 SULFATE ION × 9 P6G HEXAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100mM HEPES, pH 7.5, 1.6 M ammonium sulfate, and 2% PEG 1000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.230
3V83 The 2.1 angstrom crystal structure of diferric human transferrin Deposited 2011-12-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 2 FE FE (III) ION × 2 SO4 SULFATE ION × 9 P6G HEXAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100mM HEPES, pH 7.5, 1.6 M ammonium sulfate, and 2% PEG 1000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.230
3V83 The 2.1 angstrom crystal structure of diferric human transferrin Deposited 2011-12-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 2 FE FE (III) ION × 2 SO4 SULFATE ION × 5 P6G HEXAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100mM HEPES, pH 7.5, 1.6 M ammonium sulfate, and 2% PEG 1000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.230
3V89 The crystal structure of transferrin binding protein A (TbpA) from Neisseria meningitidis serogroup B in complex with the C-lobe of human transferrin Deposited 2011-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 356–698（343 aa） Fragment：C-lobe (UNP residues 356-698)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；21% PEG 1000, 100mM sodium acetate buffer (pH 4.8), 200mM NaCl, 0.1% LDAO and 3% heptane-1,2,3-triol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.10 Å R-free 0.287
3V8X The crystal structure of transferrin binding protein A (TbpA) from Neisserial meningitidis serogroup B in complex with full length human transferrin Deposited 2011-12-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–698（698 aa）	Not recorded	C8E (HYDROXYETHYLOXY)TRI(ETHYLOXY)OCTANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；20% Peg3350 and 200 mM BaBr2, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.60 Å R-free 0.267
3VE1 The 2.9 angstrom crystal structure of Transferrin binding protein B (TbpB) from serogroup B M982 Neisseria meningitidis in complex with human transferrin Deposited 2012-01-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 20–698（679 aa）	Not recorded	GOL GLYCEROL × 8 CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M sodium cacodylate pH 6.5, 14% PEG 3350, 0.1M sodium malonate, and 20% glycerol, vapor diffusion, hanging drop, temperature 293K	Resolution 2.96 Å R-free 0.249
3VE1 The 2.9 angstrom crystal structure of Transferrin binding protein B (TbpB) from serogroup B M982 Neisseria meningitidis in complex with human transferrin Deposited 2012-01-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 20–698（679 aa）	Not recorded	GOL GLYCEROL × 5 CO3 CARBONATE ION × 1 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M sodium cacodylate pH 6.5, 14% PEG 3350, 0.1M sodium malonate, and 20% glycerol, vapor diffusion, hanging drop, temperature 293K	Resolution 2.96 Å R-free 0.249
4H0W Bismuth bound human serum transferrin Deposited 2012-09-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 CO3 CARBONATE ION × 2 BS3 Bismuth(III) ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NTA NITRILOTRIACETIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；271 K；0.01M HEPES, 15% PEG3000, PH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 271K	Resolution 2.40 Å R-free 0.256
4X1B Human serum transferrin with ferric ion bound at the C-lobe only Deposited 2014-11-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 MLI MALONATE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；0.1M PIPES, 17% PEG3350, 18% Glycerol	Resolution 2.45 Å R-free 0.227
4X1D Ytterbium-bound human serum transferrin Deposited 2014-11-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	YB YTTERBIUM (III) ION × 1 MLI MALONATE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；0.1M PIPES, 17% PEG3350, 18% Glycerol	Resolution 2.80 Å R-free 0.231
4X1D Ytterbium-bound human serum transferrin Deposited 2014-11-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20–698（679 aa）	Not recorded	YB YTTERBIUM (III) ION × 1 MLI MALONATE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；0.1M PIPES, 17% PEG3350, 18% Glycerol	Resolution 2.80 Å R-free 0.231
5DYH Ti(IV) bound human serum transferrin Deposited 2015-09-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–698（698 aa）	Not recorded	CIT CITRIC ACID × 6 4TI TITANIUM ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；296 K；10-13% PEG3350 100 mM Ammonium Citrate buffer	Resolution 2.68 Å R-free 0.237
5DYH Ti(IV) bound human serum transferrin Deposited 2015-09-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–698（698 aa）	Not recorded	CIT CITRIC ACID × 5 4TI TITANIUM ION × 1 CO3 CARBONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；296 K；10-13% PEG3350 100 mM Ammonium Citrate buffer	Resolution 2.68 Å R-free 0.237
5H52 Structure of Titanium-bound human serum transferrin Deposited 2016-11-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	MLI MALONATE ION × 1 4TI TITANIUM ION × 2 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；PIPES-Na 0.1M, PEG 3350 17%, disodium malonate 8mM, glycerol 18%	Resolution 3.00 Å R-free 0.224
5WTD Structure of human serum transferrin bound ruthenium at N-lobe Deposited 2016-12-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 MLI MALONATE ION × 1 RU RUTHENIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.6；298 K；PIPES-Na 100 mM, disodium malonate 8 mM, PEG3350 17%, glycerol 18%	Resolution 2.50 Å R-free 0.214
5X5P Human serum transferrin bound to ruthenium NTA Deposited 2017-02-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	MLI MALONATE ION × 1 FE FE (III) ION × 1 RU RUTHENIUM ION × 4 NTA NITRILOTRIACETIC ACID × 2 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.6；298 K；PIPES-Na 100mM pH 6.6, disodium malonate 8mM, PEG 3350 18%, glycerol 17%	Resolution 2.70 Å R-free 0.219
5Y6K Human serum trnasferrin bound to a fluorescent probe Deposited 2017-08-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	MLI MALONATE ION × 1 FE FE (III) ION × 2 8R6 (2S)-6-[2-(7-azido-4-methyl-2-oxidanylidene-chromen-3-yl)ethanoylamino]-2-[bis(2-hydroxy-2-oxoethyl)amino]hexanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.6；298 K；PIPES-Na 0.1M pH 6.6, disodium malonate 8mM, PEG 3350 17%, glycerol 18%	Resolution 2.86 Å R-free 0.235
6CTC Crystal structure of human transferrin bound to Triferic FPC iron pyrophosphate Deposited 2018-03-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 2 CO3 CARBONATE ION × 1 POP PYROPHOSPHATE 2- × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；291 K；Apo human transferrin (ProSpec pro-325 purified by Q-sepharose) at 56 mg/mL (0.76 mM) against Morpheus screen condition D4 12.5% PEG 1000, 12.5% PEG3350, 12.5% MPD, 0.02 M each 1,6-hexanediol, 1-butanol, RS-1,2-propanediol, 2-propanol, 1,4-butanediol, 1,3-propanediol, 0.1 M MES/imidazole pH 6.5, crystal tracking ID 246352d4, unique puck ID suv0-5	Resolution 2.60 Å R-free 0.253
6D03 Cryo-EM structure of a Plasmodium vivax invasion complex essential for entry into human reticulocytes; one molecule of parasite ligand. Deposited 2018-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–698（698 aa） Chain D 1–698（698 aa）	Not recorded	CA CALCIUM ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 FE FE (III) ION × 4 CO3 CARBONATE ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.68 Å
6D04 Cryo-EM structure of a Plasmodium vivax invasion complex essential for entry into human reticulocytes; two molecules of parasite ligand, subclass 1. Deposited 2018-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–698（698 aa） Chain D 1–698（698 aa）	Not recorded	CA CALCIUM ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 FE FE (III) ION × 4 CO3 CARBONATE ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
6D05 Cryo-EM structure of a Plasmodium vivax invasion complex essential for entry into human reticulocytes; two molecules of parasite ligand, subclass 2. Deposited 2018-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–698（698 aa） Chain D 1–698（698 aa）	Not recorded	CA CALCIUM ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 FE FE (III) ION × 4 CO3 CARBONATE ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6JAS Human serum transferrin with iron citrate bound Deposited 2019-01-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 2 MLI MALONATE ION × 1 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.6；298 K；PIPES-NaOH 0.1M pH 6.6, di-sodium malonate 8 mM, glycerol 18%, PEG3350 17%	Resolution 2.50 Å R-free 0.219
6SOY Trypanosoma brucei transferrin receptor in complex with human transferrin Deposited 2019-08-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 22–698（677 aa）	Not recorded	FE FE (III) ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；12% (w/v) PEG 5000 MME, 12% 2-methyl-2,4-pentanediol, 0.1 M MES, pH 6.5	Resolution 2.75 Å R-free 0.233
6SOZ Glycosylated Trypanosoma brucei transferrin receptor in complex with human transferrin Deposited 2019-08-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 22–698（677 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 FE FE (III) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；12% (w/v) PEG 5000 MME, 12% 2-methyl-2,4-pentanediol, 0.1 M MES, pH 6.5	Resolution 3.42 Å R-free 0.241
7FFM Human serum transferrin with five osmium binding sites Deposited 2021-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	4TI TITANIUM ION × 1 MLI MALONATE ION × 1 NTA NITRILOTRIACETIC ACID × 1 OS OSMIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.6；298 K；PIPES-Na 100mM pH 6.5, di-sodium malonate 8mM, PEG3350 17%, glycerol 18%	Resolution 3.06 Å R-free 0.212
7FFU Osmium-bound human serum transferrin Deposited 2021-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 MLI MALONATE ION × 1 OS OSMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.6；298 K；PIPES-NaOH 0.1M pH 6.6, disodium malonate 8mM, glycerol 18%, PEG 3350 17%	Resolution 2.60 Å R-free 0.229
7Q1L Glycosilated Human Serum Apo-tranferrin Deposited 2021-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–698（676 aa）	Not recorded	GOL GLYCEROL × 5 EDO 1,2-ETHANEDIOL × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291.5 K；0.2 M Ammonium Citrate pH 7.0, 20% PEG 3350	Resolution 3.00 Å R-free 0.249
7Q1L Glycosilated Human Serum Apo-tranferrin Deposited 2021-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 23–698（676 aa）	Not recorded	GOL GLYCEROL × 2 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291.5 K；0.2 M Ammonium Citrate pH 7.0, 20% PEG 3350	Resolution 3.00 Å R-free 0.249
8BRC Crystal structure of the adduct between human serum transferrin and cisplatin Deposited 2022-11-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 MLI MALONATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PT PLATINUM (II) ION × 1 NH3 AMMONIA × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；15% w/v PEG 3350, 16% v/v glycerol, 8 mM disodium malonate, and 150 mM Na-PIPES pH 6.5	Resolution 3.17 Å R-free 0.243
9CDQ Transferrin Binding Protein A in complex with transferrin (iron bound in N lobe only) Deposited 2024-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 1 FE FE (III) ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.76 Å
9CLM Transferrin Binding Protein A in complex with transferrin binding protein B and two molecules of transferrin Deposited 2024-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 1–698（698 aa） Chain G 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 3 FE FE (III) ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
9CLT Transferrin Binding Protein A in complex with transferrin binding protein B and transferrin (iron bound to N lobe only) Deposited 2024-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 1 FE FE (III) ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9CMG Transferrin Binding Protein A in complex with transferrin binding protein B and transferrin (iron bound in both lobes of Tf) Deposited 2024-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 2 FE FE (III) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.71 Å
9DC4 Transferrin Binding Protein A in complex with transferrin binding protein B, transferrin and globular domain of TonB Deposited 2024-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 1–696（696 aa）	Not recorded	BCT BICARBONATE ION × 1 FE FE (III) ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9H49 Crystal structure of the adduct between human serum transferrin (apo-form) and cisplatin Deposited 2024-10-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	CIT CITRIC ACID × 3 PT PLATINUM (II) ION × 2 NH3 AMMONIA × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；20% w/v PEG 3350 and 200 mM ammonium citrate pH 7.0	Resolution 3.52 Å R-free 0.249
9H49 Crystal structure of the adduct between human serum transferrin (apo-form) and cisplatin Deposited 2024-10-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20–698（679 aa）	Not recorded	CIT CITRIC ACID × 3 PT PLATINUM (II) ION × 2 NH3 AMMONIA × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；20% w/v PEG 3350 and 200 mM ammonium citrate pH 7.0	Resolution 3.52 Å R-free 0.249
9H4V Crystal structure of the adduct formed upon reaction of aurothiomalate with human serum transferrin (apo-form) Deposited 2024-10-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–698（679 aa）	Not recorded	CIT CITRIC ACID × 4 AU GOLD ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20% w/v PEG 3350 and 200 mM trisodium citrate	Resolution 3.02 Å R-free 0.296
9H4V Crystal structure of the adduct formed upon reaction of aurothiomalate with human serum transferrin (apo-form) Deposited 2024-10-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20–698（679 aa）	Not recorded	CIT CITRIC ACID × 4 AU GOLD ION × 10 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20% w/v PEG 3350 and 200 mM trisodium citrate	Resolution 3.02 Å R-free 0.296
9PA8 NmTbpB and Tf protein complex Deposited 2025-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 2 FE FE (III) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9THO Crystal structure of the adduct formed upon reaction of [V(IV)O(acetylacetonate)2] with human serum transferrin with Fe(III) bound at the C-lobe only Deposited 2025-12-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 20–698（679 aa）	Not recorded	BCT BICARBONATE ION × 11 GOL GLYCEROL × 2 FE FE (III) ION × 1 MLA MALONIC ACID × 1 A1JJT bis(oxidanyl)-oxidanylidene-(oxidanyl(oxidanylidene)vanadio)oxy-vanadium × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；15% (w/v) PEG 3350, 16% (v/v) glycerol, 8 mM disodium malonate, 150 mM Na-PIPES pH 6.5	Resolution 2.55 Å R-free 0.249
9THQ Crystal structure of the human serum transferrin with Fe(III) bound at the C-lobe only Deposited 2025-12-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 MLA MALONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 GOL GLYCEROL × 1 BCT BICARBONATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；15% (w/v) PEG 3350, 16% (v/v) glycerol, 8 mM disodium malonate, 150 mM Na-PIPES pH 6.5	Resolution 2.44 Å R-free 0.231
9THR Crystal structure of the human serum transferrin with Fe(III) bound at the C-lobe only (treated with DMSO) Deposited 2025-12-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 20–698（679 aa）	Not recorded	FE FE (III) ION × 1 MLA MALONIC ACID × 1 GOL GLYCEROL × 1 BCT BICARBONATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；15% (w/v) PEG 3350, 16% (v/v) glycerol, 8 mM disodium malonate, 150 mM Na-PIPES pH 6.5	Resolution 3.20 Å R-free 0.249
9YZ4 Neisseria gonorrhoeae Transferrin Binding Protein A in complex with Transferrin Binding Protein B and transferrin (iron bound in N lobe only) Deposited 2025-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–698（698 aa）	Not recorded	BCT BICARBONATE ION × 1 FE FE (III) ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.26 Å

64 other PDB entries and 86 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TRFE_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–337； UniProt 20–356 Author chain B； PDBConstruct 1–337； UniProt 20–356 Author chain C； PDBConstruct 1–337； UniProt 20–356 Author chain D； PDBConstruct 1–337； UniProt 20–356 Author chain E； PDBConstruct 1–337； UniProt 20–356 Author chain F； PDBConstruct 1–337； UniProt 20–356 Author chain G； PDBConstruct 1–337； UniProt 20–356 Author chain H； PDBConstruct 1–337； UniProt 20–356 Author chain I； PDBConstruct 1–337； UniProt 20–356

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2o7u
Deposition date deposition_date	2006-12-11
Structure title title	Crystal structure of K206E/K296E mutant of the N-terminal half molecule of human transferrin
Keywords keywords	Human transferrin, Iron binding protein, Dilysine pair, METAL TRANSPORT; METAL TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	47.60 Å
Radius of gyration Rg (electron density) rg_electron	46.95 Å
Forward intensity I(0) i0	1624670000.00
Molecular weight molecular_weight	328110.0 kDa
Excluded volume excluded_volume	407060 Å³
Envelope volume envelope_volume	561640 Å³
Hydration-shell volume shell_volume	96546 Å³
Envelope diameter envelope_diameter	153.7 Å
Shell Rg shell_rg	53.93 Å
Envelope Rg envelope_rg	45.73 Å
Shape Rg shape_rg	46.94 Å
Total Rg total_rg	47.23 Å
Total atoms total_atoms	22995
Residues n_residues	2961
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	148.3 Å
Rg (real space) rg_real	47.25 Å
Rg uncertainty (real space) rg_real_error	0.93 Å
I(0) (real space) i0_real	1.6250e+09
I(0) uncertainty (real space) i0_real_error	2.8540e+07
Rg (reciprocal space) rg_reciprocal	47.60 Å
I(0) (reciprocal space) i0_reciprocal	1625000000.0000
Solution quality estimate total_estimate	0.8938
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	62.9 Å
Skewness Skewness skewness	0.065
Kurtosis Kurtosis kurtosis	-0.540
Angular range angular_range	— – 0.1650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	89160000.0000
Real-space data points n_real_points	34
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.919; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.962; Smooth: 0.896

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Serotransferrin
Molecular weight formula_weight	37215.1 kDa
Mutation mutation	K206E, K296E
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A,C,D,E,F,G,H,I
Atom count atom_count	23067

VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTD

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Mesocricetus auratus

Entity 2 Entity 2 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 3 Entity 3 non-polymer

Description description	CARBONATE ION
Molecular weight formula_weight	60.0 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	72

▼

7. Fold Classification (SCOP + CATH) 27 domains

SCOP 2.08 (9 domains)

Domain ID domain_id	d2o7ua_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

Domain ID domain_id	d2o7ub_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

Domain ID domain_id	d2o7uc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

Domain ID domain_id	d2o7ud_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

Domain ID domain_id	d2o7ue_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

Domain ID domain_id	d2o7uf_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

Domain ID domain_id	d2o7ug_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

Domain ID domain_id	d2o7uh_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

Domain ID domain_id	d2o7ui_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.94 — Periplasmic binding protein-like II
Superfamily Superfamily superfamily	c.94.1 — Periplasmic binding protein-like II
Family Family family	c.94.1.2 — Transferrin

CATH v4.4 (18 domains)

Domain ID domain_id	2o7uA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uC01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uC02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uD01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uD02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uE02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uF01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uF02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uG01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uG02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uH01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uH02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uI01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

Domain ID domain_id	2o7uI02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	190 — D-Maltodextrin-Binding Protein; domain 2
Homologous superfamily homologous superfamily	10 — Periplasmic binding protein-like II

▶

8. Citations (1)

▶

Unit-cell length a length_a	169.462 Å
Unit-cell length b length_b	97.897 Å
Unit-cell length c length_c	208.953 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.01 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	29.760 Å
R factor r_factor	0.2311
R_work r_work	0.2296
R_free r_free	0.2589

fit	/app/data/saxs_computation/o7/2o7u/2o7u.fit
pddf	/app/data/pr_computation/o7/2o7u/2o7u.pr.out
profile	/app/data/saxs_computation/o7/2o7u/2o7u.dat