SAXSdb — 2rc4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone acetyltransferase MYST3

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 501–784	Fragment：HAT domain	ZN ZINC ION × 1 ACO ACETYL COENZYME *A × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 6.5；298 K；sodium cacodylate, PEG 3350, pH 6.5, VAPOR DIFFUSION, temperature 298K	Resolution 3.00 Å R-free 0.283

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2RC4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1M36 Solution Structure of a CCHC Zinc Finger from MOZ Deposited 2002-06-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 533–563（31 aa） Fragment：residues 3-33	Not recorded	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 5.6；298 K；Pressure ambient NMR sample composition 0.5mM MOZ protein (533-563), 1mM TCEP, 0.7mM ZnSO4, 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2LN0 Structure of MOZ Deposited 2011-12-15	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 204–313（110 aa） Fragment：UNP RESIDUES 204-313	Not recorded	ZN ZINC ION × 4	SOLUTION NMR NMR measurement conditions pH 8；298 K；Ionic strength (raw mmCIF value) 0.1；Pressure ambient NMR sample composition 50 mM HEPES-1, 100 mM sodium chloride-2, 1 mM [U-100% 13C; U-100% 15N] entity_1-3, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 50 mM HEPES-4, 100 mM sodium chloride-5, 1 mM [U-100% 13C; U-100% 15N] entity_1-6, 100% D2O \| 100% D2O	Resolution not provided
2OZU Crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A Deposited 2007-02-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 497–780（284 aa） Fragment：Catalytic region: residues 497-780	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 1 ACO ACETYL COENZYME A × 1 ACM* ACETAMIDE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；300 K；12% PEG 5000, 0.1 M Bis-Tris, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 2.30 Å R-free 0.245
3V43 Crystal structure of MOZ Deposited 2011-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 204–313（110 aa） Fragment：UNP RESIDUES 204-313	Not recorded	ZN ZINC ION × 4 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；293 K；0.2M ammonium acetate, 0.1M tri-sodium citrate, 30% w/v PEG 4000, pH 5.6, vapor diffusion, hanging drop, temperature 293K	Resolution 1.47 Å R-free 0.176
4LJN Crystal Structure of MOZ double PHD finger Deposited 2013-07-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；60% tacsimate, pH 7, VAPOR DIFFUSION, temperature 293K	Resolution 3.00 Å R-free 0.242
4LK9 Crystal Structure of MOZ double PHD finger histone H3 tail complex Deposited 2013-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；283 K；100 mM Na-Hepes, 1.4 M sodium citrate, pH 7.5, VAPOR DIFFUSION, temperature 283K	Resolution 1.60 Å R-free 0.186
4LKA Crystal Structure of MOZ double PHD finger histone H3K9ac complex Deposited 2013-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；283 K；100 mM Na-Hepes, 1.4 M sodium citrate, pH 7.5, vapor diffusion, temperature 283K	Resolution 1.61 Å R-free 0.185
4LLB Crystal Structure of MOZ double PHD finger histone H3K14ac complex Deposited 2013-07-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；283 K；100 mM Tris-Cl, 200 mM Li2SO4, 30% PEG 4000, pH 8.5, VAPOR DIFFUSION, temperature 283K	Resolution 2.50 Å R-free 0.266
4LLB Crystal Structure of MOZ double PHD finger histone H3K14ac complex Deposited 2013-07-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；283 K；100 mM Tris-Cl, 200 mM Li2SO4, 30% PEG 4000, pH 8.5, VAPOR DIFFUSION, temperature 283K	Resolution 2.50 Å R-free 0.266
5B75 Crystal structure of MOZ double PHD finger in complex with histone H3 butyrylation at K14 Deposited 2016-06-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：UNP residues 194-323	Not recorded	ZN ZINC ION × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；polyethylene glycol 4000, lithium sulfate, Tris	Resolution 1.70 Å R-free 0.195
5B76 Crystal structure of MOZ double PHD finger domain in complex with histone H3 crotonylation at K14 Deposited 2016-06-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：UNP residues 194-323	Not recorded	ZN ZINC ION × 4 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；polyethylene glycol 4000, lithium sulfate, Tris	Resolution 1.65 Å R-free 0.236
5B77 Crystal structrue of MOZ double PHD finger in complex with histone H3 propionylation at K14 Deposited 2016-06-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：UNP residues 194-323	Not recorded	ZN ZINC ION × 4 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；polyethylene glycol 4000, lithium sulfate, Tris	Resolution 1.55 Å R-free 0.204
5B78 Crystal structure of MOZ double PHD finger mutant-S210D/N235R in complex with histone H3 crotonylation at K14 Deposited 2016-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：UNP residues 194-323	Mutation：S210D, N235R	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；polyethylene glycol 4000, lithium sulfate, Tris	Resolution 1.40 Å R-free 0.187
6LSB Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide Deposited 2020-01-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：DPF domain of MOZ	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；0.1 M HEPES pH 7.5, 1.4 M sodium citrate tribasic dehydrate.	Resolution 2.00 Å R-free 0.205
7Y43 Crystal structure of the KAT6A WH domain and its bound double stranded DNA Deposited 2022-06-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–85（85 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M magnesium acetate tetrahydrate, 20% polyethylene glycol 3,350	Resolution 1.50 Å R-free 0.235
8DD5 Crystal structure of KAT6A in complex with inhibitor CTx-648 (PF-9363) Deposited 2022-06-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 501–784（284 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	R7L 2,6-dimethoxy-N-{4-methoxy-6-[(1H-pyrazol-1-yl)methyl]-1,2-benzoxazol-3-yl}benzene-1-sulfonamide × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；100 mM sodium chloride 100 mM HEPES (pH 6.64) 1.8 M ammonium sulfate	Resolution 2.58 Å R-free 0.263
8H7A Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA Deposited 2022-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 1–85（85 aa） Chain B 1–85（85 aa）	Not recorded	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.01 M Magnesium chloride hexahydrate, 0.005 M Nickel(II) chloride hexahydrate, 0.1 M HEPES sodium pH 7.0, 15% w/v Polyethylene glycol 3,350	Resolution 1.92 Å R-free 0.235
8H7A Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA Deposited 2022-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain E 1–85（85 aa） Chain F 1–85（85 aa）	Not recorded	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.01 M Magnesium chloride hexahydrate, 0.005 M Nickel(II) chloride hexahydrate, 0.1 M HEPES sodium pH 7.0, 15% w/v Polyethylene glycol 3,350	Resolution 1.92 Å R-free 0.235
9ARO Crystal structure of AF9 YEATS domain in complex with acetylated at K1007 MOZ Deposited 2024-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1005–1008（4 aa） Chain F 1005–1008（4 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	FMT FORMIC ACID × 2 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；291 K；0.2 M Sodium formate pH 7.2, 20% (w/v) PEG 3350	Resolution 2.30 Å R-free 0.273
9ARO Crystal structure of AF9 YEATS domain in complex with acetylated at K1007 MOZ Deposited 2024-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 1005–1008（4 aa） Chain H 1005–1008（4 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；291 K；0.2 M Sodium formate pH 7.2, 20% (w/v) PEG 3350	Resolution 2.30 Å R-free 0.273
9ARR Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014 MOZ Deposited 2024-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1005–1017（13 aa） Fragment：residues 1005-1017 (Uniprot numbering)	Non-standard monomer：Yes (specific site not provided by mmCIF)	LI LITHIUM ION × 2 NO3 NITRATE ION × 4 PEG DI(HYDROXYETHYL)ETHER × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；291 K；0.2 M Lithium nitrate pH 7.1, 20% w/v PEG 3350	Resolution 2.10 Å R-free 0.247
9DZN KAT6A MYST domain complexed with a H3K14-CoA bisubstrate inhibitor Deposited 2024-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 501–784（284 aa） Fragment：MYST domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	CMC CARBOXYMETHYL COENZYME A × 1 ZN ZINC ION × 1 GOL* GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.4；294.15 K；1.25 M NH4SO4, 0.28 M NaCl, and 0.1 M HEPES pH 6.4	Resolution 1.72 Å R-free 0.245
9FKR KAT6A IN COMPLEX WITH SMALL MOLECULE INHIBITOR BAY-184 Deposited 2024-06-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 509–778（270 aa） Chain B 509–778（270 aa）	Mutation：R507G, C508S, C638S, C646S, C723S, C773S Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：R507G, C508S, C638S, C646S, C723S, C773S Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 2 A1IDR 6-(dimethylamino)-~{N}-(2-phenylphenyl)sulfonyl-1-benzofuran-2-carboxamide × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.3；298 K；RESERVOIR 100 MILLIMOLAR HEPES PH 7.1-7.5, 17-21% PEG 3350 (W/V). PROTEIN CONCENTRATION 7.1 MG/ML, PROTEIN PREINCUBATED WITH 4 MILLIMOLAR ACETYL-COA. DROPS MADE FROM 0.8 MICROLITER PROTEIN AND 0.8 MICROLITER RESERVOIR SOLUTION. CRYSTAL WASHED IN RESERVOIR SOLUTION, THEN COMPOUND BACKSOAKED FOR 10 DAYS AT 10 MILLIMOLAR.	Resolution 2.69 Å R-free 0.238

20 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MYST3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–284； UniProt 501–784

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2rc4
Deposition date deposition_date	2007-09-19
Structure title title	Crystal Structure of the HAT domain of the human MOZ protein
Keywords keywords	;Coenzyme A binding domain, zinc-finger, helix-turn-helix, Activator, Acyltransferase, Chromatin regulator, Metal-binding, Nucleus, Phosphorylation, Proto-oncogene, Repressor, Transcription, Transcription regulation, Transferase ;; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	20.61 Å
Radius of gyration Rg (electron density) rg_electron	19.61 Å
Forward intensity I(0) i0	16829900.00
Molecular weight molecular_weight	30606.0 kDa
Excluded volume excluded_volume	38173 Å³
Envelope volume envelope_volume	45802 Å³
Hydration-shell volume shell_volume	19868 Å³
Envelope diameter envelope_diameter	72.6 Å
Shell Rg shell_rg	25.90 Å
Envelope Rg envelope_rg	20.14 Å
Shape Rg shape_rg	19.58 Å
Total Rg total_rg	20.63 Å
Total atoms total_atoms	2145
Residues n_residues	264
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	70.7 Å
Rg (real space) rg_real	20.62 Å
Rg uncertainty (real space) rg_real_error	0.53 Å
I(0) (real space) i0_real	1.6830e+07
I(0) uncertainty (real space) i0_real_error	2.2810e+05
Rg (reciprocal space) rg_reciprocal	20.62 Å
I(0) (reciprocal space) i0_reciprocal	16830000.0000
Solution quality estimate total_estimate	0.6384
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	24.6 Å
Skewness Skewness skewness	0.447
Kurtosis Kurtosis kurtosis	-0.044
Angular range angular_range	— – 0.3850 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	3943000.0000
Real-space data points n_real_points	70
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.717; Stabil: 0.999; Sysdev: 0.387; Positv: 1.000; Valcen: 0.986; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Histone acetyltransferase MYST3
Molecular weight formula_weight	34021.6 kDa
EC 编号 ec_number	2.3.1.48, 2.3.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2157

PPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVRRRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIVSNSKKK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	ACETYL COENZYME *A
Molecular weight formula_weight	809.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	12

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2rc4a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.108 — Acyl-CoA N-acyltransferases (Nat)
Superfamily Superfamily superfamily	d.108.1 — Acyl-CoA N-acyltransferases (Nat)
Family Family family	d.108.1.1 — N-acetyl transferase, NAT

CATH v4.4 (3 domains)

Domain ID domain_id	2rc4A01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	60 — Wheat Germ Agglutinin (Isolectin 2); domain 1
Homologous superfamily homologous superfamily	60 — N-acetyl transferase-like

Domain ID domain_id	2rc4A02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	630 — Aminopeptidase
Homologous superfamily homologous superfamily	30 — Gcn5-related N-acetyltransferase (GNAT)

Domain ID domain_id	2rc4A03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	109.200 Å
Unit-cell length b length_b	109.200 Å
Unit-cell length c length_c	144.779 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	I 4 2 2
Space-group number int_tables_number	97
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2770
R_work r_work	0.2760
R_free r_free	0.2830

fit	/app/data/saxs_computation/rc/2rc4/2rc4.fit
pddf	/app/data/pr_computation/rc/2rc4/2rc4.pr.out
profile	/app/data/saxs_computation/rc/2rc4/2rc4.dat

Crystal Structure of the HAT domain of the human MOZ protein