SAXSdb — 6lsb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone acetyltransferase KAT6A

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 194–323	Fragment：DPF domain of MOZ	Histone H3 × 1 ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；0.1 M HEPES pH 7.5, 1.4 M sodium citrate tribasic dehydrate.	Resolution 2.00 Å R-free 0.205

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6LSB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1M36 Solution Structure of a CCHC Zinc Finger from MOZ Deposited 2002-06-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 533–563（31 aa） Fragment：residues 3-33	Not recorded	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 5.6；298 K；Pressure ambient NMR sample composition 0.5mM MOZ protein (533-563), 1mM TCEP, 0.7mM ZnSO4, 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2LN0 Structure of MOZ Deposited 2011-12-15	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 204–313（110 aa） Fragment：UNP RESIDUES 204-313	Not recorded	ZN ZINC ION × 4	SOLUTION NMR NMR measurement conditions pH 8；298 K；Ionic strength (raw mmCIF value) 0.1；Pressure ambient NMR sample composition 50 mM HEPES-1, 100 mM sodium chloride-2, 1 mM [U-100% 13C; U-100% 15N] entity_1-3, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 50 mM HEPES-4, 100 mM sodium chloride-5, 1 mM [U-100% 13C; U-100% 15N] entity_1-6, 100% D2O \| 100% D2O	Resolution not provided
2OZU Crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A Deposited 2007-02-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 497–780（284 aa） Fragment：Catalytic region: residues 497-780	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 1 ACO ACETYL COENZYME A × 1 ACM* ACETAMIDE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；300 K；12% PEG 5000, 0.1 M Bis-Tris, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 2.30 Å R-free 0.245
2RC4 Crystal Structure of the HAT domain of the human MOZ protein Deposited 2007-09-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 501–784（284 aa） Fragment：HAT domain	Not recorded	ZN ZINC ION × 1 ACO ACETYL COENZYME *A × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；298 K；sodium cacodylate, PEG 3350, pH 6.5, VAPOR DIFFUSION, temperature 298K	Resolution 3.00 Å R-free 0.283
3V43 Crystal structure of MOZ Deposited 2011-12-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 204–313（110 aa） Fragment：UNP RESIDUES 204-313	Not recorded	ZN ZINC ION × 4 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；293 K；0.2M ammonium acetate, 0.1M tri-sodium citrate, 30% w/v PEG 4000, pH 5.6, vapor diffusion, hanging drop, temperature 293K	Resolution 1.47 Å R-free 0.176
4LJN Crystal Structure of MOZ double PHD finger Deposited 2013-07-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；60% tacsimate, pH 7, VAPOR DIFFUSION, temperature 293K	Resolution 3.00 Å R-free 0.242
4LK9 Crystal Structure of MOZ double PHD finger histone H3 tail complex Deposited 2013-07-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；283 K；100 mM Na-Hepes, 1.4 M sodium citrate, pH 7.5, VAPOR DIFFUSION, temperature 283K	Resolution 1.60 Å R-free 0.186
4LKA Crystal Structure of MOZ double PHD finger histone H3K9ac complex Deposited 2013-07-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；283 K；100 mM Na-Hepes, 1.4 M sodium citrate, pH 7.5, vapor diffusion, temperature 283K	Resolution 1.61 Å R-free 0.185
4LLB Crystal Structure of MOZ double PHD finger histone H3K14ac complex Deposited 2013-07-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；283 K；100 mM Tris-Cl, 200 mM Li2SO4, 30% PEG 4000, pH 8.5, VAPOR DIFFUSION, temperature 283K	Resolution 2.50 Å R-free 0.266
4LLB Crystal Structure of MOZ double PHD finger histone H3K14ac complex Deposited 2013-07-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 194–323（130 aa） Fragment：unp residues 194-323	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；283 K；100 mM Tris-Cl, 200 mM Li2SO4, 30% PEG 4000, pH 8.5, VAPOR DIFFUSION, temperature 283K	Resolution 2.50 Å R-free 0.266
5B75 Crystal structure of MOZ double PHD finger in complex with histone H3 butyrylation at K14 Deposited 2016-06-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：UNP residues 194-323	Not recorded	ZN ZINC ION × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；polyethylene glycol 4000, lithium sulfate, Tris	Resolution 1.70 Å R-free 0.195
5B76 Crystal structure of MOZ double PHD finger domain in complex with histone H3 crotonylation at K14 Deposited 2016-06-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：UNP residues 194-323	Not recorded	ZN ZINC ION × 4 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；polyethylene glycol 4000, lithium sulfate, Tris	Resolution 1.65 Å R-free 0.236
5B77 Crystal structrue of MOZ double PHD finger in complex with histone H3 propionylation at K14 Deposited 2016-06-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：UNP residues 194-323	Not recorded	ZN ZINC ION × 4 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；polyethylene glycol 4000, lithium sulfate, Tris	Resolution 1.55 Å R-free 0.204
5B78 Crystal structure of MOZ double PHD finger mutant-S210D/N235R in complex with histone H3 crotonylation at K14 Deposited 2016-06-05	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 194–323（130 aa） Fragment：UNP residues 194-323	Mutation：S210D, N235R	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；polyethylene glycol 4000, lithium sulfate, Tris	Resolution 1.40 Å R-free 0.187
7Y43 Crystal structure of the KAT6A WH domain and its bound double stranded DNA Deposited 2022-06-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–85（85 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M magnesium acetate tetrahydrate, 20% polyethylene glycol 3,350	Resolution 1.50 Å R-free 0.235
8DD5 Crystal structure of KAT6A in complex with inhibitor CTx-648 (PF-9363) Deposited 2022-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 501–784（284 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	R7L 2,6-dimethoxy-N-{4-methoxy-6-[(1H-pyrazol-1-yl)methyl]-1,2-benzoxazol-3-yl}benzene-1-sulfonamide × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；100 mM sodium chloride 100 mM HEPES (pH 6.64) 1.8 M ammonium sulfate	Resolution 2.58 Å R-free 0.263
8H7A Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA Deposited 2022-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 1–85（85 aa） Chain B 1–85（85 aa）	Not recorded	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.01 M Magnesium chloride hexahydrate, 0.005 M Nickel(II) chloride hexahydrate, 0.1 M HEPES sodium pH 7.0, 15% w/v Polyethylene glycol 3,350	Resolution 1.92 Å R-free 0.235
8H7A Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA Deposited 2022-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain E 1–85（85 aa） Chain F 1–85（85 aa）	Not recorded	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.01 M Magnesium chloride hexahydrate, 0.005 M Nickel(II) chloride hexahydrate, 0.1 M HEPES sodium pH 7.0, 15% w/v Polyethylene glycol 3,350	Resolution 1.92 Å R-free 0.235
9ARO Crystal structure of AF9 YEATS domain in complex with acetylated at K1007 MOZ Deposited 2024-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1005–1008（4 aa） Chain F 1005–1008（4 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	FMT FORMIC ACID × 2 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；291 K；0.2 M Sodium formate pH 7.2, 20% (w/v) PEG 3350	Resolution 2.30 Å R-free 0.273
9ARO Crystal structure of AF9 YEATS domain in complex with acetylated at K1007 MOZ Deposited 2024-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 1005–1008（4 aa） Chain H 1005–1008（4 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；291 K；0.2 M Sodium formate pH 7.2, 20% (w/v) PEG 3350	Resolution 2.30 Å R-free 0.273
9ARR Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014 MOZ Deposited 2024-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1005–1017（13 aa） Fragment：residues 1005-1017 (Uniprot numbering)	Non-standard monomer：Yes (specific site not provided by mmCIF)	LI LITHIUM ION × 2 NO3 NITRATE ION × 4 PEG DI(HYDROXYETHYL)ETHER × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；291 K；0.2 M Lithium nitrate pH 7.1, 20% w/v PEG 3350	Resolution 2.10 Å R-free 0.247
9DZN KAT6A MYST domain complexed with a H3K14-CoA bisubstrate inhibitor Deposited 2024-10-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 501–784（284 aa） Fragment：MYST domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	CMC CARBOXYMETHYL COENZYME A × 1 ZN ZINC ION × 1 GOL* GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.4；294.15 K；1.25 M NH4SO4, 0.28 M NaCl, and 0.1 M HEPES pH 6.4	Resolution 1.72 Å R-free 0.245
9FKR KAT6A IN COMPLEX WITH SMALL MOLECULE INHIBITOR BAY-184 Deposited 2024-06-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 509–778（270 aa） Chain B 509–778（270 aa）	Mutation：R507G, C508S, C638S, C646S, C723S, C773S Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：R507G, C508S, C638S, C646S, C723S, C773S Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 2 A1IDR 6-(dimethylamino)-~{N}-(2-phenylphenyl)sulfonyl-1-benzofuran-2-carboxamide × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.3；298 K；RESERVOIR 100 MILLIMOLAR HEPES PH 7.1-7.5, 17-21% PEG 3350 (W/V). PROTEIN CONCENTRATION 7.1 MG/ML, PROTEIN PREINCUBATED WITH 4 MILLIMOLAR ACETYL-COA. DROPS MADE FROM 0.8 MICROLITER PROTEIN AND 0.8 MICROLITER RESERVOIR SOLUTION. CRYSTAL WASHED IN RESERVOIR SOLUTION, THEN COMPOUND BACKSOAKED FOR 10 DAYS AT 10 MILLIMOLAR.	Resolution 2.69 Å R-free 0.238

20 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KAT6A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–131； UniProt 194–323

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6lsb
Deposition date deposition_date	2020-01-17
Structure title title	Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide
Keywords keywords	DPF domain, histone Kbz modification, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	16.14 Å
Radius of gyration Rg (electron density) rg_electron	15.49 Å
Forward intensity I(0) i0	6241440.00
Molecular weight molecular_weight	16679.0 kDa
Excluded volume excluded_volume	20261 Å³
Envelope volume envelope_volume	23698 Å³
Hydration-shell volume shell_volume	13218 Å³
Envelope diameter envelope_diameter	56.6 Å
Shell Rg shell_rg	21.01 Å
Envelope Rg envelope_rg	15.97 Å
Shape Rg shape_rg	15.50 Å
Total Rg total_rg	16.41 Å
Total atoms total_atoms	1139
Residues n_residues	145
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	56.1 Å
Rg (real space) rg_real	16.11 Å
Rg uncertainty (real space) rg_real_error	0.37 Å
I(0) (real space) i0_real	6.2410e+06
I(0) uncertainty (real space) i0_real_error	7.3640e+04
Rg (reciprocal space) rg_reciprocal	16.12 Å
I(0) (reciprocal space) i0_reciprocal	6241000.0000
Solution quality estimate total_estimate	0.6509
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	18.5 Å
Skewness Skewness skewness	0.341
Kurtosis Kurtosis kurtosis	-0.200
Angular range angular_range	— – 0.4950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	894400.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.740; Stabil: 1.000; Sysdev: 0.424; Positv: 1.000; Valcen: 0.965; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Histone acetyltransferase KAT6A
Molecular weight formula_weight	14930.6 kDa
EC 编号 ec_number	2.3.1.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1228

SLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKKGRKLLQKK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Histone H3
Molecular weight formula_weight	2735.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ARTKQTARKSTGGKAPRKQLATKAAX

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	89

▶

8. Citations (1)

▶

Unit-cell length a length_a	48.187 Å
Unit-cell length b length_b	48.187 Å
Unit-cell length c length_c	116.848 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	39.300 Å
R factor r_factor	0.1626
R_work r_work	0.1580
R_free r_free	0.2052

fit	/app/data/saxs_computation/ls/6lsb/6lsb.fit
pddf	/app/data/pr_computation/ls/6lsb/6lsb.pr.out
profile	/app/data/saxs_computation/ls/6lsb/6lsb.dat

Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone acetyltransferase KAT6A

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)