2rl0

Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fibronectin

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Fibronectin-binding protein × 1 （P14738） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Fibronectin-binding protein × 1 （P14738） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Fibronectin-binding protein × 1 （P14738） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Fibronectin-binding protein × 1 （P14738） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Fibronectin-binding protein × 1 （P14738） water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Fibronectin-binding protein × 1 （P14738） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FINC_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–89； UniProt 184–272 Author chain B； PDBConstruct 1–89； UniProt 184–272 Author chain D； PDBConstruct 1–89； UniProt 184–272 Author chain F； PDBConstruct 1–89； UniProt 184–272 Author chain I； PDBConstruct 1–89； UniProt 184–272 Author chain K； PDBConstruct 1–89； UniProt 184–272

Fibronectin-binding protein

OrganismNot specified

UniProt P14738

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Fibronectin × 1 （P02751） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Fibronectin × 1 （P02751） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Fibronectin × 1 （P02751） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Fibronectin × 1 （P02751） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Fibronectin × 1 （P02751） water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Fibronectin × 1 （P02751） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FNBA_STAA8
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–18； UniProt 638–655 Author chain E； PDBConstruct 1–18； UniProt 638–655 Author chain G； PDBConstruct 1–18； UniProt 638–655 Author chain H； PDBConstruct 1–18； UniProt 638–655 Author chain J； PDBConstruct 1–18； UniProt 638–655 Author chain L； PDBConstruct 1–18； UniProt 638–655

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2rl0
Deposition date deposition_date	2007-10-18
Structure title title	Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
Keywords keywords	;FIBRONECTIN, 4F15F1, BETA ZIPPER, STAPHYLOCOCCUS AUREUS, Acute phase, Alternative splicing, Cell adhesion, Extracellular matrix, Glycoprotein, Heparin-binding, Phosphorylation, Pyrrolidone carboxylic acid, Secreted, Sulfation, Cell wall, Peptidoglycan-anchor, Virulence ;; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2rl0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2rl0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2rl0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.64 Å
Rg (electron density)	16.30 Å
Total Rg	17.02 Å
Atom count	833
Residues	106
Excluded volume	14342 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2rl0__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2rl0__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2rl0__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2rl0__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2rl0__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2rl0__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Fibronectin
Molecular weight formula_weight	10137.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,F,I,K
Atom count atom_count	5338

EKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCER

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	PICHIA PASTORIS

Entity 2 Entity 2 polymer

Description description	Fibronectin-binding protein
Molecular weight formula_weight	2014.1 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,C,E,H,J,L

GQVTTESNLVEFDEESTK

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	462

▼

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d2rl0a1
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0a2
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0b1
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0b2
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0d1
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0d2
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0f1
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0f2
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0i1
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0i2
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0k1
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

Domain ID domain_id	d2rl0k2
Class class	g — Small proteins
Fold Fold fold	g.27 — FnI-like domain
Superfamily Superfamily superfamily	g.27.1 — FnI-like domain
Family Family family	g.27.1.1 — Fibronectin type I module

CATH v4.4 (12 domains)

Domain ID domain_id	2rl0A01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0A02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0B01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0B02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0D01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0D02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0F01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0F02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0I01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0I02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0K01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	2rl0K02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

▶

Unit-cell length a length_a	85.580 Å
Unit-cell length b length_b	85.580 Å
Unit-cell length c length_c	230.860 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	28.160 Å
R factor r_factor	0.2210
R_work r_work	0.2180
R_free r_free	0.2660

Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fibronectin

State in the Current Structure

Other States of the Same Protein in the Database

Fibronectin-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2rl0__assembly_1__model_1

2rl0__assembly_1__model_1 | I(q)

2rl0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (1)

Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fibronectin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fibronectin-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2rl0__assembly_1__model_1

2rl0__assembly_1__model_1 | I(q)

2rl0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (1)