SAXSdb — 2x1g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-BINDING PROTEIN 8A

DROSOPHILA MELANOGASTER

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	PROTEIN MAGO NASHI × 1 （P49028） CADMUS × 1 （Q9VEC5）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	PROTEIN MAGO NASHI × 1 （P49028） CADMUS × 1 （Q9VEC5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM8A_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–165； UniProt 1–165 Author chain C； PDBConstruct 1–165； UniProt 1–165

PROTEIN MAGO NASHI

DROSOPHILA MELANOGASTER

UniProt P49028

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	RNA-BINDING PROTEIN 8A × 1 （Q9V535） CADMUS × 1 （Q9VEC5）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	RNA-BINDING PROTEIN 8A × 1 （Q9V535） CADMUS × 1 （Q9VEC5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MGN_DROME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–147； UniProt 1–147 Author chain D； PDBConstruct 1–147； UniProt 1–147

CADMUS

DROSOPHILA MELANOGASTER

UniProt Q9VEC5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	RNA-BINDING PROTEIN 8A × 1 （Q9V535） PROTEIN MAGO NASHI × 1 （P49028）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	RNA-BINDING PROTEIN 8A × 1 （Q9V535） PROTEIN MAGO NASHI × 1 （P49028）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9VEC5_DROME
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 1–971； UniProt 1–971 Author chain G； PDBConstruct 1–971； UniProt 1–971

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2x1g
Deposition date deposition_date	2009-12-23
Structure title title	Crystal structure of Importin13 - Mago-Y14 complex
Keywords keywords	TRANSPORT PROTEIN, DEVELOPMENTAL PROTEIN, MRNA PROCESSING, NUCLEAR TRANSPORT, MRNA SPLICING, MRNA TRANSPORT; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2x1g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2x1g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2x1g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.15 Å
Rg (electron density)	33.38 Å
Total Rg	34.05 Å
Atom count	8038
Residues	1126
Excluded volume	142860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2x1g__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2x1g__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	RNA-BINDING PROTEIN 8A
Molecular weight formula_weight	19042.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	16076

MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR

Source Source

Source organism organism	DROSOPHILA MELANOGASTER
Common name common_name	FRUIT FLY
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	PROTEIN MAGO NASHI
Molecular weight formula_weight	17335.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI

Source Source

Source organism organism	DROSOPHILA MELANOGASTER
Common name common_name	FRUIT FLY
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 polymer

Description description	CADMUS
Molecular weight formula_weight	111436.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G

MEPIDIARLEEAVVSFYRSNSQNQAITHEWLTDAEASPQAWQFSWQLMQLGKSQEVQFFGAITLHSKLMKHWHEVPPENREELKQKILESIVRFAGGPKIVLNRLCISLGAYIVHMLGEWPGAIEEVINTFQNQRMPNVSADVQLWIMLEVLTAIPEEAQVIHTSVKRVVLRAEIAKRVQLVIHTVERYLKLQMNRVWDAEAYSNMNRAVKCVGTWIKNIGYTIEGCVTITAVLLEVVHKCYWPCIHAGDGCMTADENELAESCLKTMVNIIIQPDCHNYPKTAFVLIKMFLDSLSEITKTEWKRENDNEDIIVHIYMLFVSSVERHSTLLLSGITSADPELSILVHRIVQEILHCTDKPGIYPVEESCSTMALAFWYMLQDEVFAMSNDEQKHKCWEYIKPLYAHLTRILVRKSEQPDEKSLAKWSSDDLECFRCYRQDISDTFMYCYDVLNDYILEILAAMLDEAIADLQRHPTHWTKLEACIYSFQSVAEHFGGEEKRQIPRLMRVLAEIPYEKLNVKLLGTALETMGSYCNWLMENPAYIPPAINLLVRGLNSSMSAQATLGLKELCRDCQLQLKPYADPLLNACHASLNTGRMKNSDSVRLMFSIGKLMSLLRPEEIPKYLDIIVSPCFEELQAICQADSKTPAARIRTIFRLNMISTLFSSLNTDVDEQATDQPIVQPVLLVMQRTMPIFKRIAEMWVEEIDVLEAACSAMKHAITNLRSSFQPMLQDLCLFIVASFQTRCCAPTLEISKTAIVMFFKDEGCKPLMQQLLREFIQHSFKLFESTPEQNFSNISDTMETFFGCLTQIIKKIPQVLEDKTLAYDRLVFYAQRGMTLPESGAIRNSIQFLTHFVMQSRNHAHVTEVVLATGEQTLYTAMMCVGYLTPRSQVDKFADILLAMNRKYAAEMAVWMKSLMSTPNFPTQLITDADKTRYTALIIKEKVNKRLLQQHLSEMAMKTRGLTEKFQ

Source Source

Source organism organism	DROSOPHILA MELANOGASTER
Common name common_name	FRUIT FLY
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	ESCHERICHIA COLI

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	2x1gA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	2x1gB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1560 — Mago nashi protein
Homologous superfamily homologous superfamily	10 — Mago nashi

Domain ID domain_id	2x1gC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	2x1gD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1560 — Mago nashi protein
Homologous superfamily homologous superfamily	10 — Mago nashi

Domain ID domain_id	2x1gF00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

Domain ID domain_id	2x1gG00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

▶

Unit-cell length a length_a	82.569 Å
Unit-cell length b length_b	100.792 Å
Unit-cell length c length_c	93.923 Å
Unit-cell angle α angle_alpha	89.83 °
Unit-cell angle β angle_beta	110.18 °
Unit-cell angle γ angle_gamma	90.63 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.350 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2670
R_work r_work	0.2670
R_free r_free	0.2890

Crystal structure of Importin13 - Mago-Y14 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-BINDING PROTEIN 8A

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN MAGO NASHI

State in the Current Structure

Other States of the Same Protein in the Database

CADMUS

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2x1g__assembly_1__model_1

2x1g__assembly_1__model_1 | I(q)

2x1g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of Importin13 - Mago-Y14 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-BINDING PROTEIN 8A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN MAGO NASHI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CADMUS

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2x1g__assembly_1__model_1

2x1g__assembly_1__model_1 | I(q)

2x1g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)