SAXSdb — 2xhm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ANGIOTENSIN CONVERTING ENZYME

DROSOPHILA MELANOGASTER

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Monomer Protein × 1 其他Polymer 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 17–614	Fragment：RESIDUES 17-614	;beta-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 K26 N-ACETYL-L-ILE-L-TYR-(R)-1-AMINO-2-(4-HYDROXYPHENYL)ETHYLPHOSPHONIC ACID × 1 ZN ZINC ION × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7.5；pH 7.5	Resolution 1.96 Å R-free 0.215

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2XHM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1J36 Crystal Structure of Drosophila AnCE Deposited 2003-01-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 14–615（602 aa）	Not recorded	ZN ZINC ION × 1 LPR [N2-[(S)-1-CARBOXY-3-PHENYLPROPYL]-L-LYSYL-L-PROLINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；Sodium Formate 7.2M, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.280
1J36 Crystal Structure of Drosophila AnCE Deposited 2003-01-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 14–615（602 aa）	Not recorded	ZN ZINC ION × 1 LPR [N2-[(S)-1-CARBOXY-3-PHENYLPROPYL]-L-LYSYL-L-PROLINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；Sodium Formate 7.2M, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.280
1J37 Crystal Structure of Drosophila AnCE Deposited 2003-01-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 14–615（602 aa）	Not recorded	ZN ZINC ION × 1 X8Z L-CAPTOPRIL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；Sodium Formate 7.2M, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.283
1J37 Crystal Structure of Drosophila AnCE Deposited 2003-01-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 14–615（602 aa）	Not recorded	ZN ZINC ION × 1 X8Z L-CAPTOPRIL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；Sodium Formate 7.2M, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.283
1J38 Crystal Structure of Drosophila AnCE Deposited 2003-01-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 14–615（602 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；Sodium Formate 7.2M, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.281
1J38 Crystal Structure of Drosophila AnCE Deposited 2003-01-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 14–615（602 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；Sodium Formate 7.2M, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.281
2X8Y Crystal structure of AnCE Deposited 2010-03-14	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	FLC CITRATE ANION × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.90 Å R-free 0.220
2X8Z Crystal structure of AnCE-captopril complex Deposited 2010-03-14	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	X8Z L-CAPTOPRIL × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.98 Å R-free 0.216
2X90 Crystal structure of AnCE-enalaprilat complex Deposited 2010-03-14	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2 EAL 1-((2S)-2-{[(1S)-1-CARBOXY-3-PHENYLPROPYL]AMINO}PROPANOYL)-L-PROLINE × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.98 Å R-free 0.214
2X91 Crystal structure of AnCE-lisinopril complex Deposited 2010-03-14	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	LPR [N2-[(S)-1-CARBOXY-3-PHENYLPROPYL]-L-LYSYL-L-PROLINE × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 3 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.98 Å R-free 0.209
2X92 Crystal structure of AnCE-ramiprilat complex Deposited 2010-03-14	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–615（599 aa） Fragment：RESIDUES 17-615	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 X92 Ramiprilat × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.11 Å R-free 0.218
2X93 Crystal structure of AnCE-trandolaprilat complex Deposited 2010-03-14	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–615（599 aa） Fragment：RESIDUES 17-615	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 X93 TRANDOLAPRILAT × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.98 Å R-free 0.207
2X94 Crystal structure of AnCE-perindoprilat complex Deposited 2010-03-14	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–615（599 aa） Fragment：RESIDUES 17-615	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 X94 PERINDOPRILAT × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.88 Å R-free 0.213
2X95 Crystal structure of AnCE-lisinopril-tryptophan analogue, lisW-S complex Deposited 2010-03-14	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–615（599 aa） Fragment：RESIDUES 17-615	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 3 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 X95 (S)-1-N2-(1-CARBOXY-3-PHENYLPROPYL)-L-LYSYL-L-TRYPTOPHAN × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.96 Å R-free 0.216
2X96 Crystal structure of AnCE-RXPA380 complex Deposited 2010-03-14	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	RX3 N-({(1S,2R)-2-[(S)-[(1R)-1-{[(BENZYLOXY)CARBONYL]AMINO}-2-PHENYLETHYL](HYDROXY)PHOSPHORYL]CYCLOPENTYL}CARBONYL)-L-TRYPT OPHAN × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.85 Å R-free 0.215
2X97 Crystal structure of AnCE-RXP407 complex Deposited 2010-03-14	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	RX4 N~2~-acetyl-N-{(1R)-1-[(S)-[(2S)-3-{[(2S)-1-amino-1-oxopropan-2-yl]amino}-2-methyl-3-oxopropyl](hydroxy)phosphoryl]-2-phenylethyl}-L-alpha-asparagine × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.85 Å R-free 0.201
3ZQZ CRYSTAL STRUCTURE OF ANCE IN COMPLEX WITH A SELENIUM ANALOGUE OF CAPTOPRIL Deposited 2011-06-13	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SLC SELENO-CAPTOPRIL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；100 MM HEPES 7.5, 1.3 M SODIUM CITRATE.	Resolution 2.35 Å R-free 0.238
4AA1 Crystal structure of ANCE in complex with Angiotensin-II Deposited 2011-11-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M HEPES 7.5, 1.3 M SODIUM CITRATE	Resolution 1.99 Å R-free 0.211
4AA2 Crystal structure of ANCE in complex with bradykinin potentiating peptide b Deposited 2011-11-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M HEPES 7.5, 1.3 M SODIUM CITRATE	Resolution 1.99 Å R-free 0.226
4ASQ Crystal structure of ANCE in complex with Bradykinin Deposited 2012-05-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；100 MM HEPES 1.3 M SODIUM CITRATE, pH 7.5	Resolution 1.99 Å R-free 0.200
4ASR Crystal structure of ANCE in complex with Thr6-Bradykinin Deposited 2012-05-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；100 MM HEPES 1.3 M SODIUM CITRATE, pH 7.5	Resolution 1.90 Å R-free 0.200
4CA7 Drosophila Angiotensin converting enzyme (AnCE) in complex with a phosphinic tripeptide FI Deposited 2013-10-07	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 3EF N-{(2S)-3-[(S)-[(1R)-1-{[(benzyloxy)carbonyl]amino}-2-phenylethyl](hydroxy)phosphoryl]-2-[(3-phenyl-1,2-oxazol-5-yl)methyl]propanoyl}-L-tyrosine × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；100 MM HEPES 7.5, 1.3 M SODIUM CITRATE	Resolution 1.82 Å R-free 0.194
4CA8 Drosophila Angiotensin converting enzyme (AnCE) in complex with a phosphinic tripeptide FII Deposited 2013-10-07	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 17–614（598 aa） Fragment：RESIDUES 17-614	Not recorded	3ES [(2S)-2-({3-[HYDROXYL(2-PHENYL-(1R)-1-{[(BENZYLOXY)[(2S)-2-({3-[HYDROXYL(2-PHENYL-(1R)-1-CARBONYL]-AMINO}ETHYL)PHOSPHINYL]-2-[(3-PHENYLISOXAZOL-5-YL)METHYL]-1-OXO-PROPYL}AMINO)-3-(4-HYDROXY-PHENYL) × 1 SO4 SULFATE ION × 4 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；100 MM HEPES 7.5, 1.3 M SODIUM CITRATE	Resolution 1.99 Å R-free 0.216
5A2R A New Crystal Structure of the Drosophila melanogaster Angiotensin Converting Enzyme Homologue AnCE. Deposited 2015-05-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 18–615（598 aa） Fragment：RESIDUES 18-615	Not recorded	MLT D-MALATE × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4；25 % W/V PEG 1500, 0.1 M MMT PH 4.0	Resolution 1.85 Å R-free 0.186
9QA0 Drosophila melanogaster angiotensin converting enzyme homologue, AnCE in complex with IW dipeptide Deposited 2025-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 17–614（598 aa）	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；299 K；1.2 M sodium citrate, 0.1 M HEPES pH 7.5	Resolution 2.20 Å R-free 0.208
9QA1 Drosophila melanogaster angiotensin converting enzyme homologue, AnCE in complex with VW dipeptide Deposited 2025-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 19–614（596 aa）	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；1.2 M sodium citrate, 0.1 M HEPES pH 7.5	Resolution 2.20 Å R-free 0.211
9QA2 Drosophila melanogaster angiotensin converting enzyme homologue, AnCE in complex with RW dipeptide Deposited 2025-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 17–614（598 aa）	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；1.2 M sodium citrate, 0.1 M HEPES pH 7.5	Resolution 1.90 Å R-free 0.200
9QA3 Drosophila melanogaster angiotensin converting enzyme homologue, AnCE in complex with YW dipeptide Deposited 2025-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 18–614（597 aa）	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；1.2 M sodium citrate, 0.1 M HEPES pH 7.5	Resolution 2.20 Å R-free 0.206
9QA4 Drosophila melanogaster angiotensin converting enzyme homologue, AnCE in complex with WR dipeptide Deposited 2025-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 17–614（598 aa）	Not recorded	ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 FLC CITRATE ANION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；1.2 M sodium citrate, 0.1 M HEPES pH 7.5	Resolution 1.85 Å R-free 0.185

26 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACE_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–598； UniProt 17–614

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2xhm
Deposition date deposition_date	2010-06-18
Structure title title	Crystal structure of AnCE-K26 complex
Keywords keywords	HYDROLASE, ACE INHIBITOR, ZINC METALLOPEPTIDASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.49 Å
Radius of gyration Rg (electron density) rg_electron	24.35 Å
Forward intensity I(0) i0	81694300.00
Molecular weight molecular_weight	71274.0 kDa
Excluded volume excluded_volume	89132 Å³
Envelope volume envelope_volume	104480 Å³
Hydration-shell volume shell_volume	34415 Å³
Envelope diameter envelope_diameter	85.5 Å
Shell Rg shell_rg	32.91 Å
Envelope Rg envelope_rg	24.69 Å
Shape Rg shape_rg	24.32 Å
Total Rg total_rg	25.35 Å
Total atoms total_atoms	5026
Residues n_residues	598
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	82.8 Å
Rg (real space) rg_real	25.37 Å
Rg uncertainty (real space) rg_real_error	0.51 Å
I(0) (real space) i0_real	8.1690e+07
I(0) uncertainty (real space) i0_real_error	1.2750e+06
Rg (reciprocal space) rg_reciprocal	25.41 Å
I(0) (reciprocal space) i0_reciprocal	81700000.0000
Solution quality estimate total_estimate	0.7228
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	32.1 Å
Skewness Skewness skewness	0.236
Kurtosis Kurtosis kurtosis	-0.272
Angular range angular_range	— – 0.3100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	19760000.0000
Real-space data points n_real_points	63
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.826; Stabil: 1.000; Sysdev: 0.315; Positv: 1.000; Valcen: 0.989; Smooth: 0.982

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	ANGIOTENSIN CONVERTING ENZYME
Molecular weight formula_weight	69152.6 kDa
EC 编号 ec_number	3.4.15.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5532

ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNFTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMHLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKYHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS

来源 Source

来源生物 organism	DROSOPHILA MELANOGASTER
通用名 common_name	FRUIT FLY
NCBI Class编号 ncbi_taxonomy_id	7227
宿主生物 host_organism	PICHIA PASTORIS

Entity 2 Entity 2 branched

Description description	;beta-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	1073.0 kDa
Source method src_method	man
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	N-ACETYL-L-ILE-L-TYR-(R)-1-AMINO-2-(4-HYDROXYPHENYL)ETHYLPHOSPHONIC ACID
Molecular weight formula_weight	535.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	490

▼

7. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2xhma_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.92 — Zincin-like
Superfamily Superfamily superfamily	d.92.1 — Metalloproteases ('zincins'), catalytic domain
Family Family family	d.92.1.5 — Neurolysin-like

▶

8. Citations (1)

▶

Unit-cell length a length_a	172.707 Å
Unit-cell length b length_b	172.707 Å
Unit-cell length c length_c	101.696 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	9

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	1.960 Å
Low-resolution limit resolution_low	32.640 Å
R factor r_factor	0.1951
R_work r_work	0.1940
R_free r_free	0.2146

fit	/app/data/saxs_computation/xh/2xhm/2xhm.fit
pddf	/app/data/pr_computation/xh/2xhm/2xhm.pr.out
profile	/app/data/saxs_computation/xh/2xhm/2xhm.dat

Crystal structure of AnCE-K26 complex