3epd

CryoEM structure of poliovirus receptor bound to poliovirus type 3

Method: ELECTRON MICROSCOPY D_max: 141.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poliovirus receptor

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 360 PDB declaration: 360-MERIC（360） Consistent with protein copy count	Chain R； UniProt 30–242	Fragment：Poliovirus receptor CD155 D1D2 Mutation：N105D, N120S, N188Q, N218Q, N237S	Poliovirus Type3 peptide × 60 protein VP1 × 60 （Q8B3S0） protein VP2 × 60 （Q8B3S0） protein VP4 × 60 （Q8B3S0） protein VP3 × 60 （Q8B3S0） SPH SPHINGOSINE × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain R； UniProt 30–242	Fragment：Poliovirus receptor CD155 D1D2 Mutation：N105D, N120S, N188Q, N218Q, N237S	Poliovirus Type3 peptide × 1 protein VP1 × 1 （Q8B3S0） protein VP2 × 1 （Q8B3S0） protein VP4 × 1 （Q8B3S0） protein VP3 × 1 （Q8B3S0） SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å
3	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain R； UniProt 30–242	Fragment：Poliovirus receptor CD155 D1D2 Mutation：N105D, N120S, N188Q, N218Q, N237S	Poliovirus Type3 peptide × 5 protein VP1 × 5 （Q8B3S0） protein VP2 × 5 （Q8B3S0） protein VP4 × 5 （Q8B3S0） protein VP3 × 5 （Q8B3S0） SPH SPHINGOSINE × 5 MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å
4	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain R； UniProt 30–242	Fragment：Poliovirus receptor CD155 D1D2 Mutation：N105D, N120S, N188Q, N218Q, N237S	Poliovirus Type3 peptide × 6 protein VP1 × 6 （Q8B3S0） protein VP2 × 6 （Q8B3S0） protein VP4 × 6 （Q8B3S0） protein VP3 × 6 （Q8B3S0） SPH SPHINGOSINE × 6 MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å
5	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain R； UniProt 30–242	Fragment：Poliovirus receptor CD155 D1D2 Mutation：N105D, N120S, N188Q, N218Q, N237S	Poliovirus Type3 peptide × 1 protein VP1 × 1 （Q8B3S0） protein VP2 × 1 （Q8B3S0） protein VP4 × 1 （Q8B3S0） protein VP3 × 1 （Q8B3S0） SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3EPD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 420 PDB declaration: 420-MERIC	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different oligomeric state Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different oligomeric state Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 5 MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 6 MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different oligomeric state Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different oligomeric state Different ligand/ion	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different oligomeric state Different ligand/ion	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 5 MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different ligand/ion	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 6 MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different oligomeric state Different ligand/ion	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 300 PDB declaration: 300-meric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 60	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 420 PDB declaration: 420-meric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 60	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 2 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 3 Other combination Heteromer；Protein × 35 PDB declaration: 35-meric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 4 Other combination Heteromer；Protein × 42 PDB declaration: 42-meric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 5 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3UDW Crystal structure of the immunoreceptor TIGIT in complex with Poliovirus receptor (PVR/CD155/necl-5) D1 domain Deposited 2011-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 28–145（118 aa） Fragment：PVR, UNP residues 28-145 Chain D 28–145（118 aa） Fragment：PVR, UNP residues 28-145	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；0.1 M Ammonium acetate 0.1 M Bis-Tris pH 5.5 17% PEG 10000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.90 Å R-free 0.287
3URO Poliovirus receptor CD155 D1D2 Deposited 2011-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain R 29–243（215 aa） Fragment：poliovirus receptor CD155 D1D2 (UNP Residues 29-243)	Mutation：N105D, N120S, N188Q, N218Q, N237S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；100 mM MgSO4, 6.8 M NH4NO3, 100 mM Tris buffer, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.341
3URO Poliovirus receptor CD155 D1D2 Deposited 2011-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain R 29–243（215 aa） Fragment：poliovirus receptor CD155 D1D2 (UNP Residues 29-243)	Mutation：N105D, N120S, N188Q, N218Q, N237S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；100 mM MgSO4, 6.8 M NH4NO3, 100 mM Tris buffer, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.341
4FQP Crystal structure of human Nectin-like 5 full ectodomain (D1-D3) Deposited 2012-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 28–334（307 aa） Fragment：ectodomain (D1-D3, UNP residues 28-334)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293.15 K；55% v/v tacsimate, 0.1 M Bicine, pH 9.0, with additional 10% tacsimate as cryoprotectant, VAPOR DIFFUSION, HANGING DROP, temperature 293.15K	Resolution 3.60 Å R-free 0.272
6ARQ Crystal structure of CD96 (D1) bound to CD155/necl-5 (D1-3) Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 28–334（307 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；32% (v/v) Jeffamine ED-2001 0.1M HEPES pH7.3	Resolution 2.88 Å R-free 0.252
6ISC complex structure of mCD226-ecto and hCD155-D1 Deposited 2018-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 28–145（118 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.1 M Tris (pH 8.0), 0.15 M ammonium sulfate, and 15% (w/v) PEG4000	Resolution 2.20 Å R-free 0.265
6O3O Structure of human DNAM-1 (CD226) bound to nectin-like protein-5 (necl-5) Deposited 2019-02-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 28–334（307 aa） Chain D 28–334（307 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20% PEG3350, 0.18M K2SO4, 10mM EDTA	Resolution 2.80 Å R-free 0.231

12 other PDB entries and 37 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PVR_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain R； PDBConstruct 1–213； UniProt 30–242

protein VP1

Human poliovirus 3

UniProt Q8B3S0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 360 PDB declaration: 360-MERIC（360） Consistent with protein copy count	Chain 1； UniProt 600–878 Chain 2； UniProt 75–340 Chain 3； UniProt 341–575 Chain 4； UniProt 2–69	Not recorded	Poliovirus receptor × 60 （P15151） Poliovirus Type3 peptide × 60 SPH SPHINGOSINE × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain 1； UniProt 600–878 Chain 2； UniProt 75–340 Chain 3； UniProt 341–575 Chain 4； UniProt 2–69	Not recorded	Poliovirus receptor × 1 （P15151） Poliovirus Type3 peptide × 1 SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å
3	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain 1； UniProt 600–878 Chain 2； UniProt 75–340 Chain 3； UniProt 341–575 Chain 4； UniProt 2–69	Not recorded	Poliovirus receptor × 5 （P15151） Poliovirus Type3 peptide × 5 SPH SPHINGOSINE × 5 MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å
4	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain 1； UniProt 600–878 Chain 2； UniProt 75–340 Chain 3； UniProt 341–575 Chain 4； UniProt 2–69	Not recorded	Poliovirus receptor × 6 （P15151） Poliovirus Type3 peptide × 6 SPH SPHINGOSINE × 6 MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å
5	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain 1； UniProt 600–878 Chain 2； UniProt 75–340 Chain 3； UniProt 341–575 Chain 4； UniProt 2–69	Not recorded	Poliovirus receptor × 1 （P15151） Poliovirus Type3 peptide × 1 SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	Q8B3S0_9ENTO
Isoform	—
PDB entities	3, 4, 5, 6
Chains and sequence ranges	Author chain 1； PDBConstruct 1–279； UniProt 600–878 Author chain 2； PDBConstruct 1–266； UniProt 75–340 Author chain 4； PDBConstruct 1–68； UniProt 2–69 Author chain 3； PDBConstruct 1–235； UniProt 341–575

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3epd
Deposition date deposition_date	2008-09-29
Structure title title	CryoEM structure of poliovirus receptor bound to poliovirus type 3
Keywords keywords	;CD155 structure Immunoglobulin Superfamily, poliovirus capsid jelly role, Cell adhesion, Cell membrane, Glycoprotein, Host-virus interaction, Immunoglobulin domain, Membrane, Receptor, Secreted, Transmembrane, VIRAL PROTEIN, VIRUS ;; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	36.22 Å
Radius of gyration Rg (electron density) rg_electron	36.21 Å
Forward intensity I(0) i0	213722000.00
Molecular weight molecular_weight	117770.0 kDa
Excluded volume excluded_volume	147400 Å³
Envelope volume envelope_volume	202730 Å³
Hydration-shell volume shell_volume	48304 Å³
Envelope diameter envelope_diameter	150.1 Å
Shell Rg shell_rg	40.41 Å
Envelope Rg envelope_rg	37.71 Å
Shape Rg shape_rg	36.17 Å
Total Rg total_rg	36.67 Å
Total atoms total_atoms	8290
Residues n_residues	1058
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	141.8 Å
Rg (real space) rg_real	36.48 Å
Rg uncertainty (real space) rg_real_error	1.60 Å
I(0) (real space) i0_real	2.1370e+08
I(0) uncertainty (real space) i0_real_error	3.4450e+06
Rg (reciprocal space) rg_reciprocal	36.31 Å
I(0) (reciprocal space) i0_reciprocal	213700000.0000
Solution quality estimate total_estimate	0.7895
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	38.7 Å
Skewness Skewness skewness	0.653
Kurtosis Kurtosis kurtosis	0.441
Angular range angular_range	— – 0.2200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	34120000.0000
Real-space data points n_real_points	45
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.512; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.748; Smooth: 0.975

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Poliovirus receptor
Molecular weight formula_weight	23330.5 kDa
Mutation mutation	N105D, N120S, N188Q, N218Q, N237S
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R
Atom count atom_count	8290

VVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRDASLRMFGLRVEDEGSYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPQTSQVPGFLSGTVTVTSLWILVPSSQVDGKQVTCKVEHESFEKPQLLTVSLTVYY

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Poliovirus Type3 peptide
Molecular weight formula_weight	446.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

ISEV

Entity 3 Entity 3 polymer

Description description	protein VP1
Molecular weight formula_weight	31358.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

QDSLPDTKASGPAHSKEVPALTAVETGATNPLAPSDTVQTRHVVQRRSRSESTIESFFARGACVAIIEVDNEQPTTRAQKLFAMWRITYKDTVQLRRKLEFFTYSRFDMEFTFVVTANFTNANNGHALNQVYQIMYIPPGAPTPKSWDDYTWQTSSNPSIFYTYGAAPARISVPYVGLANAYSHFYDGFAKVPLKTDANDQIGDSLYSAMTVDDFGVLAVRVVNDHNPTKVTSKVRIYMKPKHVRVWCPRPPRAVPYYGPGVDYRNNLDPLSEKGLTTY

来源 Source

来源生物 organism	Human poliovirus 3
NCBI Class编号 ncbi_taxonomy_id	12086
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	protein VP2
Molecular weight formula_weight	29643.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

ACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEFIRDDEANPVDQPTEPDVATCRFYTLDTVMWGKESKGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYCLAGDSDKQRYTSYANANPGERGGKFYSQFNKDNAVTSPKREFCPVDYLLGCGVLLGNAFVYPHQIINLRTNNSATIVLPYVNALAIDSMVKHNNWGIAILPLSPLDFAQDSSVEIPITVTIAPMCSEFNGLRNVTAPKFQ

来源 Source

来源生物 organism	Human poliovirus 3
NCBI Class编号 ncbi_taxonomy_id	12086
宿主生物 host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	protein VP4
Molecular weight formula_weight	7320.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAQVSSQKVGAHENSNRAYGGSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN

来源 Source

来源生物 organism	Human poliovirus 3
NCBI Class编号 ncbi_taxonomy_id	12086
宿主生物 host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	protein VP3
Molecular weight formula_weight	25950.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPVLNTPGSNQYLTSDNHQSPCAIPEFDVTPPIDIPGEVKNMMELAEIDTMIPLNLESTKRNTMDMYRVTLSDSADLSQPILCLSLSPAFDPRLSHTMLGEVLNYYTHWAGSLKFTFLFCGSMMATGKILVAYAPPGAQPPTSRKEAMLGTHVIWDLGLQSSCTMVVPWISNVTYRQTTQDSFTEGGYISMFYQTRIVVPLSTPKSMSMLGFVSACNDFSVRLLRDTTHISQSA

来源 Source

来源生物 organism	Human poliovirus 3
NCBI Class编号 ncbi_taxonomy_id	12086
宿主生物 host_organism	Escherichia coli

Entity 7 Entity 7 non-polymer

Description description	SPHINGOSINE
Molecular weight formula_weight	299.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	9.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	—

fit	/app/data/saxs_computation/ep/3epd/3epd.fit
pddf	/app/data/pr_computation/ep/3epd/3epd.pr.out
profile	/app/data/saxs_computation/ep/3epd/3epd.dat

CryoEM structure of poliovirus receptor bound to poliovirus type 3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poliovirus receptor

State in the Current Structure

Other States of the Same Protein in the Database

protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)