3iy8

Leishmania tarentolae Mitonchondrial Ribosome small subunit

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S5

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S17 × 1 （P0AG63） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS5_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–150； UniProt 10–159

30S ribosomal protein S6

OrganismNot specified

UniProt P02358

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S17 × 1 （P0AG63） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS6_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 1–100； UniProt 1–100

30S ribosomal protein S8

OrganismNot specified

UniProt P0A7W7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S17 × 1 （P0AG63） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–129； UniProt 2–130

30S ribosomal protein S9

OrganismNot specified

UniProt P0A7X3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S17 × 1 （P0AG63） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS9_ECOLI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–127； UniProt 4–130

30S ribosomal protein S11

OrganismNot specified

UniProt P0A7R9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S17 × 1 （P0AG63） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS11_ECOLI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain K； PDBConstruct 1–117； UniProt 13–129

30S ribosomal protein S12

OrganismNot specified

UniProt P0A7S3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S17 × 1 （P0AG63） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_ECOLI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain L； PDBConstruct 1–123； UniProt 2–124

30S ribosomal protein S15

OrganismNot specified

UniProt Q8X9M2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S17 × 1 （P0AG63） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS15_ECO57
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain O； PDBConstruct 1–88； UniProt 2–89

30S ribosomal protein S16

OrganismNot specified

UniProt P0A7T3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S17 × 1 （P0AG63） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS16_ECOLI
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain P； PDBConstruct 1–82； UniProt 1–82

30S ribosomal protein S17

OrganismNot specified

UniProt P0AG63

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S18 × 1 （Q1R358）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17_ECOLI
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Q； PDBConstruct 1–80； UniProt 4–83

30S ribosomal protein S18

OrganismNot specified

UniProt Q1R358

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	Leishmania tarentolae mitochondrial small subunit × 1 30S ribosomal protein S5 × 1 （P0A7W1） 30S ribosomal protein S6 × 1 （P02358） 30S ribosomal protein S8 × 1 （P0A7W7） 30S ribosomal protein S9 × 1 （P0A7X3） 30S ribosomal protein S11 × 1 （P0A7R9） 30S ribosomal protein S12 × 1 （P0A7S3） 30S ribosomal protein S15 × 1 （Q8X9M2） 30S ribosomal protein S16 × 1 （P0A7T3） 30S ribosomal protein S17 × 1 （P0AG63）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS18_ECOUT
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain R； PDBConstruct 1–55； UniProt 20–74

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3iy8
Deposition date deposition_date	2009-04-16
Structure title title	Leishmania tarentolae Mitonchondrial Ribosome small subunit
Keywords keywords	;Leishmania tarentolae, Mitochondrial ribosome, CryoEM, Minimal RNA., Antibiotic resistance, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, Repressor, Translation regulation, tRNA-binding, Methylation, Endonuclease, Hydrolase, Nuclease, RIBOSOME ;; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3iy8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3iy8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3iy8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.74 Å
Rg (electron density)	60.73 Å
Total Rg	60.52 Å
Atom count	540
Residues	540
Excluded volume	147120 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3iy8__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Leishmania tarentolae mitochondrial small subunit
Molecular weight formula_weight	172221.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	1591

AUUAUACGUAGUCAAUUGUUAUUAUUCAUAUUAAUUUUUUUAAAAGUUUUUUAAUUUUAUAUUAGUUUAUUUGUUUACAAAUUUAAAUUAUAUUUCAUUAUUUAGGAAUAGUUAAUUAGAUUUAUUUGUUAAUGCUAUUAAAGGGGUGUGGAAAAAGUGUUAAAUUAUUUAUAUAUUUAAAUAAUAAAUAAAAUAUAACUUAUUAGUCAGAAAUGGAUGCGAGCCGUUGCGGUAAUUUCUAUGCUUUUAAAUAUUAUACAUUUAUUUUAUUAUAUAUGCAAAUAAAAAAUGACACAUUAAUUAUUAAUUAUAUUAUAUUAUAUUUAUUCACAUAAGUCAACAAUAUCUAUUUACUGUUUUUGACAACAUGAUAAGGAUUAUAAAUGGAAUUAUAAUUUUAUAAUCAAAACUAAUUUAUUAUAUUAAAUUAGCAUGUUUAGAUAAAACAAUAAAUUUAGAAGGUAUUCUUGCCCACCAUUCUUUGUAAUAAAGACAACGUGCAGUAAUUAAUAUAUUUAUAAAAAUAUAUUUUCUCAUGUU

Entity 2 Entity 2 polymer

Description description	30S ribosomal protein S5
Molecular weight formula_weight	15804.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK

Entity 3 Entity 3 polymer

Description description	30S ribosomal protein S6
Molecular weight formula_weight	11669.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS

Entity 4 Entity 4 polymer

Description description	30S ribosomal protein S8
Molecular weight formula_weight	14015.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA

Entity 5 Entity 5 polymer

Description description	30S ribosomal protein S9
Molecular weight formula_weight	14554.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR

Entity 6 Entity 6 polymer

Description description	30S ribosomal protein S11
Molecular weight formula_weight	12487.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV

Entity 7 Entity 7 polymer

Description description	30S ribosomal protein S12
Molecular weight formula_weight	13637.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA

Entity 8 Entity 8 polymer

Description description	30S ribosomal protein S15
Molecular weight formula_weight	10188.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTRLIERLGLRR

Entity 9 Entity 9 polymer

Description description	30S ribosomal protein S16
Molecular weight formula_weight	9207.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKEVNKAA

Entity 10 Entity 10 polymer

Description description	30S ribosomal protein S17
Molecular weight formula_weight	9263.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAV

Entity 11 Entity 11 polymer

Description description	30S ribosomal protein S18
Molecular weight formula_weight	6466.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRH

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	14.10 Å
Resolution测定Method resolution_method	Projection Matching
颗粒数 num_particles	53475

Leishmania tarentolae Mitonchondrial Ribosome small subunit

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S18

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer