SAXSdb — 3l5j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-6 receptor subunit beta

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 323–610	Fragment：UNP residues 323-610	EDO 1,2-ETHANEDIOL × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；PEG 8000, NaCl, Tris-HCl, pH 8.5, vapor diffusion, hanging drop, temperature 293K	Resolution 3.04 Å R-free 0.265
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 323–610	Fragment：UNP residues 323-610	CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；PEG 8000, NaCl, Tris-HCl, pH 8.5, vapor diffusion, hanging drop, temperature 293K	Resolution 3.04 Å R-free 0.265

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3L5J	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BJ8 THIRD N-TERMINAL DOMAIN OF GP130, NMR, MINIMIZED AVERAGE STRUCTURE Deposited 1998-07-02	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 219–325（107 aa） Fragment：THIRD N-TERMINAL DOMAIN	Mutation：V1M, Y2D	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Ionic strength (raw mmCIF value) 200 mM NACL；Pressure 1 NMR sample composition WATER	Resolution not provided
1BQU CYTOKYNE-BINDING REGION OF GP130 Deposited 1998-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 119–333（215 aa） Fragment：CYTOKINE-BINDING REGION DOMAINS Chain B 119–333（215 aa） Fragment：CYTOKINE-BINDING REGION DOMAINS	Not recorded	SO4 SULFATE ION × 6 GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；1.8-2.1M AMMONIUM SULFATE, 0.1M TRIS PH 8.0	Resolution 2.00 Å R-free 0.255
1I1R CRYSTAL STRUCTURE OF A CYTOKINE/RECEPTOR COMPLEX Deposited 2001-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 23–325（303 aa） Fragment：DOMAINS 1, 2, 3 OF THE GP130 EXTRACELLULAR DOMAIN (RESIDUES 1-303)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；MPEG 2000, sodium citrate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.256
1P9M Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex Deposited 2003-05-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 23–321（299 aa） Fragment：extracellular domains D1 - D3	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；Sodium formate, Sodium acetate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.65 Å R-free 0.334
1PVH Crystal structure of leukemia inhibitory factor in complex with gp130 Deposited 2003-06-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 123–323（201 aa） Fragment：domains D2 and D3	Not recorded	IOD IODIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；PEG 3350, Sodium iodide, Imidazole, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.289
1PVH Crystal structure of leukemia inhibitory factor in complex with gp130 Deposited 2003-06-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 123–323（201 aa） Fragment：domains D2 and D3	Not recorded	IOD IODIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；PEG 3350, Sodium iodide, Imidazole, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.289
3L5H Crystal structure of the full ectodomain of human gp130: New insights into the molecular assembly of receptor complexes Deposited 2009-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–612（589 aa） Fragment：ecotodomain	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6；298 K；1.5-2.0M (NH4)2SO4, 0.1M imidazole-malonate buffer, pH 6.0, EVAPORATION, temperature 298K	Resolution 3.60 Å R-free 0.335
3L5I Crystal structure of FnIII domains of human GP130 (Domains 4-6) Deposited 2009-12-22	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 323–612（290 aa） Fragment：UNP residues 323-612	Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 17 CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；PEG 8000, NaCl, Tris-HCl, pH 8.5, vapor diffusion, hanging drop, temperature 293K	Resolution 1.90 Å R-free 0.222
7U7N IL-27 quaternary receptor signaling complex Deposited 2022-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 23–321（299 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；The grids were blotted for 3 seconds with an offset of 3.	Resolution 3.47 Å
8D6A Cryo-EM structure of human LIF signaling complex: model containing the interaction core region Deposited 2022-06-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 23–619（597 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.54 Å
8D74 Cryo-EM structure of human CNTF signaling complex: model containing the interaction core region Deposited 2022-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 23–619（597 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.03 Å
8D7R Cryo-EM structure of human CLCF1 signaling complex: model containing the interaction core region Deposited 2022-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 23–619（597 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
8D82 Cryo-EM structure of human IL-6 signaling complex in detergent: model containing full extracellular domains Deposited 2022-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 23–700（678 aa） Chain E 23–700（678 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.22 Å
8D85 Cryo-EM structure of human IL-27 signaling complex: model containing the interaction core region Deposited 2022-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 23–619（597 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.81 Å
8DPS The structure of the interleukin 11 signalling complex, truncated gp130 Deposited 2022-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 22–324（303 aa） Chain D 22–324（303 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5；TBS pH 85 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8DPT The structure of the IL-11 signalling complex, with full-length extracellular gp130 Deposited 2022-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 22–612（591 aa） Chain D 22–612（591 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8DPU The crystal structure of the IL-11 signalling complex Deposited 2022-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 22–324（303 aa） Chain D 22–324（303 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.25；293 K；180 mM magnesium chloride, 15.3% PEG 3350, 100 mM potassium sodium tartrate, 90 mM sodium HEPES pH 7.25 and 1.8% tert-butanol	Resolution 3.78 Å R-free 0.295
8DPU The crystal structure of the IL-11 signalling complex Deposited 2022-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 22–324（303 aa） Chain J 22–324（303 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.25；293 K；180 mM magnesium chloride, 15.3% PEG 3350, 100 mM potassium sodium tartrate, 90 mM sodium HEPES pH 7.25 and 1.8% tert-butanol	Resolution 3.78 Å R-free 0.295
8DPU The crystal structure of the IL-11 signalling complex Deposited 2022-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain M 22–324（303 aa） Chain P 22–324（303 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.25；293 K；180 mM magnesium chloride, 15.3% PEG 3350, 100 mM potassium sodium tartrate, 90 mM sodium HEPES pH 7.25 and 1.8% tert-butanol	Resolution 3.78 Å R-free 0.295
8UPA Structure of gp130 in complex with a de novo designed IL-6 mimetic Deposited 2023-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 124–321（198 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.04M Potassium phosphate monobasic, 16% Polyethylene glycol 8,000, 20% Glycerol	Resolution 3.30 Å R-free 0.236
8UPA Structure of gp130 in complex with a de novo designed IL-6 mimetic Deposited 2023-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 124–321（198 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.04M Potassium phosphate monobasic, 16% Polyethylene glycol 8,000, 20% Glycerol	Resolution 3.30 Å R-free 0.236
8V29 Cryo-EM structure of human type I OSM receptor complex: model for full extracellular assembly Deposited 2023-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 23–619（597 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.99 Å
8V2A Cryo-EM structure of human type I OSM receptor complex: model for assembly core region Deposited 2023-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 23–619（597 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.59 Å

19 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL6RB_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–288； UniProt 323–610 Author chain B； PDBConstruct 1–288； UniProt 323–610

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3l5j
Deposition date deposition_date	2009-12-22
Structure title title	Crystal structure of FnIII domains of human GP130 (Domains 4-6)
Keywords keywords	Cytokine Receptor, Fibronectin Type III domain, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	34.12 Å
Radius of gyration Rg (electron density) rg_electron	33.20 Å
Forward intensity I(0) i0	58824200.00
Molecular weight molecular_weight	60883.0 kDa
Excluded volume excluded_volume	76114 Å³
Envelope volume envelope_volume	108630 Å³
Hydration-shell volume shell_volume	28172 Å³
Envelope diameter envelope_diameter	96.6 Å
Shell Rg shell_rg	38.86 Å
Envelope Rg envelope_rg	31.99 Å
Shape Rg shape_rg	33.20 Å
Total Rg total_rg	33.70 Å
Total atoms total_atoms	4300
Residues n_residues	569
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	98.9 Å
Rg (real space) rg_real	33.96 Å
Rg uncertainty (real space) rg_real_error	0.60 Å
I(0) (real space) i0_real	5.8820e+07
I(0) uncertainty (real space) i0_real_error	7.2460e+05
Rg (reciprocal space) rg_reciprocal	34.07 Å
I(0) (reciprocal space) i0_reciprocal	58830000.0000
Solution quality estimate total_estimate	0.8970
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	55.9 Å
Skewness Skewness skewness	-0.110
Kurtosis Kurtosis kurtosis	-0.892
Angular range angular_range	— – 0.2300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	3056000.0000
Real-space data points n_real_points	47
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.925; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.983; Smooth: 0.900

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Interleukin-6 receptor subunit beta
Molecular weight formula_weight	32671.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4315

EDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	15

▼

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	3l5jA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3l5jA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3l5jA03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3l5jB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3l5jB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3l5jB03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	102.936 Å
Unit-cell length b length_b	89.221 Å
Unit-cell length c length_c	106.877 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	117.72 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	3.042 Å
Low-resolution limit resolution_low	35.154 Å
R factor r_factor	0.2150
R_work r_work	0.2130
R_free r_free	0.2650

fit	/app/data/saxs_computation/l5/3l5j/3l5j.fit
pddf	/app/data/pr_computation/l5/3l5j/3l5j.pr.out
profile	/app/data/saxs_computation/l5/3l5j/3l5j.dat

Crystal structure of FnIII domains of human GP130 (Domains 4-6)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-6 receptor subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction