SAXSdb — 3ri4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Isoform Ets-1 p27 of Protein C-ets-1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Homooligomer Protein × 2 DNA 4 PDB declaration: hexameric（6） Consistent with all polymer counts	Chain A； UniProt 64–225 Chain D； UniProt 64–225	Fragment：UNP residues 280-441	TCR alpha promoter DNA × 2 TCR alpha promoter DNA × 2	X-RAY DIFFRACTION X-ray crystallization conditions：sitting drop vapor diffusion and macroseeding；pH 8.5；295 K；200 mM ammonium chloride, 10 mM calcium chloride, 50 mM Tris-HCl buffer (pH 8.5), 18.5% v/v PEG MME 2000, 3% v/v glycerol, sitting drop vapor diffusion and macroseeding, temperature 295K	Resolution 3.00 Å R-free 0.284

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3RI4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1GVJ ETS-1 DNA BINDING AND AUTOINHIBITORY DOMAINS Deposited 2002-02-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 297–441（145 aa） Fragment：RESIDUES 297-441 Chain B 297–441（145 aa） Fragment：RESIDUES 297-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；297 K；0.2 M AMMONIUM ACETATE, 30% W/V PEG 4000, 0.1 M SODIUM CITRATE PH 5.6, PROTEIN CONCENTRATION 15 MG/ML PLUS 10 MM DTT, TEMPERATURE 297 K, FOR CRYOPROTECTION 10% OF PEG 400 WAS ADDED.	Resolution 1.53 Å R-free 0.235
2NNY Crystal structure of the Ets1 dimer DNA complex. Deposited 2006-10-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 280–441（162 aa） Fragment：residues 280-441 Chain B 280–441（162 aa） Fragment：residues 280-441	Mutation：C350S , C416S Mutation：C350S , C416S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；0.2 M ammonium acetate 28% PEG 2000 0.1 M sodium citrate, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 100K, temperature 298K	Resolution 2.58 Å R-free 0.271
2STT SOLUTION NMR STRUCTURE OF THE HUMAN ETS1/DNA COMPLEX, 25 STRUCTURES Deposited 1996-08-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 320–415（96 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；305 K	Resolution not provided
2STW SOLUTION NMR STRUCTURE OF THE HUMAN ETS1/DNA COMPLEX, RESTRAINED REGULARIZED MEAN STRUCTURE Deposited 1996-08-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 320–415（96 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；305 K	Resolution not provided
3MFK Ets1 complex with stromelysin-1 promoter DNA Deposited 2010-04-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 280–441（162 aa） Fragment：UNP residues 280-441 Chain B 280–441（162 aa） Fragment：UNP residues 280-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295 K；15 mM ammonium chloride, 15 mM magnesium chloride, 0.7 M NDSB-195, 40 mM MES buffer (pH 6.5) and 11.5% v/v 2-Propanol, VAPOR DIFFUSION, SITTING DROP, temperature 295 K	Resolution 3.00 Å R-free 0.289
3WTS Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；10% PEG 4000, 0.1M AMMONIUM ACETATE, 0.05M TRIS HCL, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.279
3WTS Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain H 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；10% PEG 4000, 0.1M AMMONIUM ACETATE, 0.05M TRIS HCL, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.279
3WTT Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；10% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.277
3WTT Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain H 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；10% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.277
3WTU Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4% PEG 8000, 0.1M AMMONIUM ACETATE, 0.02M MAGNESIUM CHLORIDE, 0.05M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.282
3WTU Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain H 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4% PEG 8000, 0.1M AMMONIUM ACETATE, 0.02M MAGNESIUM CHLORIDE, 0.05M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.282
3WTV Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4% PEG 8000, 0.1M AMMONIUM ACETATE, 0.02M MAGNESIUM CHLORIDE, 0.05M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.284
3WTV Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain H 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4% PEG 8000, 0.1M AMMONIUM ACETATE, 0.02M MAGNESIUM CHLORIDE, 0.05M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.284
3WTW Crystal structure of the complex comprised of ETS1(K167A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；12% ISOPROPANOL, 0.02M MAGNESIUM CHLORIDE, 0.05M MES, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.90 Å R-free 0.264
3WTW Crystal structure of the complex comprised of ETS1(K167A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain H 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；12% ISOPROPANOL, 0.02M MAGNESIUM CHLORIDE, 0.05M MES, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.90 Å R-free 0.264
3WTX Crystal structure of the complex comprised of ETS1(Y329A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Mutation：Y329A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；298 K；10% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE PH5.8, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.271
3WTX Crystal structure of the complex comprised of ETS1(Y329A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain H 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Mutation：Y329A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；298 K；10% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE PH5.8, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.271
3WTY Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Mutation：G333P	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；298 K；4% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE, pH 5.8, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.268
3WTY Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain H 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Mutation：G333P	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；298 K；4% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE, pH 5.8, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.268
3WTZ Crystal structure of ETS-1 DNA binding and autoinhibitory domains (276-441) Deposited 2014-04-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 276–441（166 aa） Fragment：UNP RESIDUES 276-441 Chain B 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；9% MPD, 6% PEG 6000, 0.1M HEPES, pH 7.8, VAPOR DIFFUSION, SITTING DROP	Resolution 2.61 Å R-free 0.252
3WU0 Crystal structure of phosphorylated ETS-1 DNA binding and autoinhibitory domains (276-441) Deposited 2014-04-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 276–441（166 aa） Fragment：UNP RESIDUES 276-441 Chain B 276–441（166 aa） Fragment：UNP RESIDUES 276-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；5% PEG 3000, 25% MPD, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.60 Å R-free 0.277
3WU1 Crystal structure of the ETS1-RUNX1-DNA ternary complex Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 333–441（109 aa） Fragment：UNP RESIDUES 333-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；298 K；11% PEG MME 550, 0.1M KCL, 0.015M MGCL2, 0.05M TRIS, pH 7.5, VAPOR DIFFUSION, temperature 298K	Resolution 2.40 Å R-free 0.249
4L0Y Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1) Deposited 2013-06-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 296–441（146 aa） Fragment：UNP residues 296-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；298 K；Plate-shaped crystals grown from 100 mM potassium chloride, 15 mM magnesium chloride hexahydrate, 25 mM MES, pH 5.6, 14% v/v PEG550 MME, 6% v/v glycerol, crystal size improved by macroseeding, VAPOR DIFFUSION, temperature 298K	Resolution 2.50 Å R-free 0.245
4L0Z Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 2) Deposited 2013-06-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 296–441（146 aa） Fragment：UNP residues 296-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；Square bipyramid-shaped crystals grown from 100 mM potassium chloride, 15 mM magnesium chloride hexahydrate, 25 mM MES, pH 5.6, 14% v/v PEG550 MME, 6% v/v glycerol, crystal size improved by macroseeding, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.272
4L18 Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3) Deposited 2013-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 296–441（146 aa） Fragment：UNP residues 296-441	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；2.5% w/v PEG4000, 5 mM magnesium chloride hexahydrate, 25 mM MES, pH 5.6, 5% v/v glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.280
4L18 Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3) Deposited 2013-06-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain F 296–441（146 aa） Fragment：UNP residues 296-441	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；2.5% w/v PEG4000, 5 mM magnesium chloride hexahydrate, 25 mM MES, pH 5.6, 5% v/v glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.280
4LG0 Structure of a ternary FOXO1-ETS1 DNA complex Deposited 2013-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 331–440（110 aa） Fragment：DNA binding domain, UNP residues 331-440	Not recorded	CA CALCIUM ION × 1 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291 K；30% PEG 400, 0.05M 2-Amino-2-hydroxymethyl-propane-1,3-diol, 0.1M potassium chloride, 0.01M magnesium chloride, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.19 Å R-free 0.243
5ZMC Structural Basis for Reactivation of -146C>T Mutant TERT Promoter by cooperative binding of p52 and ETS1/2 Deposited 2018-04-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 331–441（111 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；290 K；0.1 M HEPES pH 7.0 and 2.0 M Ammonium sulphate	Resolution 2.99 Å R-free 0.288

20 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ETS1_HUMAN
Isoform	P14921-4
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–163； UniProt 64–225 Author chain D； PDBConstruct 2–163； UniProt 64–225

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ri4
Deposition date deposition_date	2011-04-12
Structure title title	Ets1 cooperative binding to widely separated sites on promoter DNA
Keywords keywords	;transcription, T-cell receptor alpha, DNA binding, autoinhibition, Ets domain, transcription factor, DNA, Runx2, Runx1, Transcription-DNA complex ;; Transcription/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	24.90 Å
Radius of gyration Rg (electron density) rg_electron	23.82 Å
Forward intensity I(0) i0	65178000.00
Molecular weight molecular_weight	51188.0 kDa
Excluded volume excluded_volume	58893 Å³
Envelope volume envelope_volume	75628 Å³
Hydration-shell volume shell_volume	26786 Å³
Envelope diameter envelope_diameter	82.0 Å
Shell Rg shell_rg	30.56 Å
Envelope Rg envelope_rg	23.44 Å
Shape Rg shape_rg	23.77 Å
Total Rg total_rg	24.58 Å
Total atoms total_atoms	3534
Residues n_residues	336
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	78.4 Å
Rg (real space) rg_real	24.78 Å
Rg uncertainty (real space) rg_real_error	0.47 Å
I(0) (real space) i0_real	6.5180e+07
I(0) uncertainty (real space) i0_real_error	9.1750e+05
Rg (reciprocal space) rg_reciprocal	24.81 Å
I(0) (reciprocal space) i0_reciprocal	65180000.0000
Solution quality estimate total_estimate	0.9032
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	32.4 Å
Skewness Skewness skewness	0.195
Kurtosis Kurtosis kurtosis	-0.385
Angular range angular_range	— – 0.3200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	5044000.0000
Real-space data points n_real_points	64
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.915; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.992

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Isoform Ets-1 p27 of Protein C-ets-1
Molecular weight formula_weight	18938.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	3567

MVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	TCR alpha promoter DNA
Molecular weight formula_weight	4843.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	B,E

GGAAGCCACATCCTCT

Entity 3 Entity 3 polymer

Description description	TCR alpha promoter DNA
Molecular weight formula_weight	4954.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C,F

CAGAGGATGTGGCTTC

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	33

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3ri4a_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.5 — 'Winged helix' DNA-binding domain
Family Family family	a.4.5.21 — ets domain

Domain ID domain_id	d3ri4d_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.5 — 'Winged helix' DNA-binding domain
Family Family family	a.4.5.21 — ets domain

CATH v4.4 (2 domains)

Domain ID domain_id	3ri4A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3ri4D00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	50.177 Å
Unit-cell length b length_b	98.124 Å
Unit-cell length c length_c	53.577 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	109.67 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	29.840 Å
R factor r_factor	0.2300
R_work r_work	0.2300
R_free r_free	0.2840

fit	/app/data/saxs_computation/ri/3ri4/3ri4.fit
pddf	/app/data/pr_computation/ri/3ri4/3ri4.pr.out
profile	/app/data/saxs_computation/ri/3ri4/3ri4.dat

Ets1 cooperative binding to widely separated sites on promoter DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Isoform Ets-1 p27 of Protein C-ets-1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)