SAXSdb — 3uen

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA topoisomerase 2-binding protein 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 549–746	Fragment：BRCT domain	SCN THIOCYANATE ION × 1 GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；PEG 3350, NaSCN, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.224

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3UEN	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1WF6 The third BRCA1 C-terminus (BRCT) domain of Similar to S.pombe rad4+/cut5+ product Deposited 2004-05-26	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 354–472（119 aa） Fragment：BRCA1 C-turminus (BRCT) domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 220mM；Pressure ambient NMR sample composition 1.06mM 13C/15N-labeled protein; 20mM d-TRIS, 200mM NaCl, 1mM d-DTT, and 0.02% NaN3 \| 90% H2O/10% D2O	Resolution not provided
2XNH Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor TopBP1 Deposited 2010-08-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–287（287 aa） Fragment：BRCT 0,1 AND 2, RESIDUES 1-287	Non-standard monomer：Yes (specific site not provided by mmCIF)	IOD IODIDE ION × 17	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.8；0.1M TRIS-HCL PH 6.8, 0.5M KI, 5% (V/V) GLYCEROL, 22.5% (W/V), 10% PEG 3350	Resolution 2.80 Å R-free 0.251
2XNK Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor TopBP1 Deposited 2010-08-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–290（290 aa） Fragment：BRCT 0,1 AND 2, RESIDUES 1-290	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M TRIS-HCL PH 7.5, 0.4 M MGCL2, 25% PEG 4000, 4% GLYCEROL, 0.01 M SPERMIDINE TETRA-HCL	Resolution 2.60 Å R-free 0.266
2XNK Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor TopBP1 Deposited 2010-08-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–290（290 aa） Fragment：BRCT 0,1 AND 2, RESIDUES 1-290	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M TRIS-HCL PH 7.5, 0.4 M MGCL2, 25% PEG 4000, 4% GLYCEROL, 0.01 M SPERMIDINE TETRA-HCL	Resolution 2.60 Å R-free 0.266
2XNK Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor TopBP1 Deposited 2010-08-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–290（290 aa） Fragment：BRCT 0,1 AND 2, RESIDUES 1-290	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M TRIS-HCL PH 7.5, 0.4 M MGCL2, 25% PEG 4000, 4% GLYCEROL, 0.01 M SPERMIDINE TETRA-HCL	Resolution 2.60 Å R-free 0.266
2XNK Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor TopBP1 Deposited 2010-08-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–290（290 aa） Fragment：BRCT 0,1 AND 2, RESIDUES 1-290	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M TRIS-HCL PH 7.5, 0.4 M MGCL2, 25% PEG 4000, 4% GLYCEROL, 0.01 M SPERMIDINE TETRA-HCL	Resolution 2.60 Å R-free 0.266
3AL2 Crystal Structure of TopBP1 BRCT7/8 Deposited 2010-07-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1264–1493（230 aa） Fragment：BRCT7 and BRCT8, UNP residues 1264-1493	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；Li2SO4, Tris-HCl, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.204
3AL3 Crystal Structure of TopBP1 BRCT7/8-BACH1 peptide complex Deposited 2010-07-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1264–1493（230 aa） Fragment：BRCT7 and BRCT8, UNP residues 1264-1493	Not recorded	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；Sodium formate, pH 8, vapor diffusion, hanging drop, temperature 298K	Resolution 2.15 Å R-free 0.236
3JVE Crystal Structure of the Sixth BRCT Domain of TopBP1 Deposited 2009-09-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 893–996（104 aa） Fragment：C-terminus (BRCT) domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；0.1M Tris-HCl pH 6.8, PEG 2000 MME, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.34 Å R-free 0.173
3OLC Crystal structure of the N-terminal region of TopBP1 Deposited 2010-08-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 1–290（290 aa） Fragment：N-terminal domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；289 K；0.1M MES, 11%(w/v) PEG3350, 0.85M sodium nitrate, 2mM EDTA, 4mM DTT, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.40 Å R-free 0.258
3PD7 Crystal Structure of the Sixth BRCT Domain of Human TopBP1 Deposited 2010-10-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 893–994（102 aa） Fragment：Sixth BRCT domain, UNP residues 893-994	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；295 K；20% PEG 4000, 0.2 M sodium acetate trihydrate, 0.1 M Tris-HCl, pH 6.6, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.26 Å R-free 0.144
3PD7 Crystal Structure of the Sixth BRCT Domain of Human TopBP1 Deposited 2010-10-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 893–994（102 aa） Fragment：Sixth BRCT domain, UNP residues 893-994	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；295 K；20% PEG 4000, 0.2 M sodium acetate trihydrate, 0.1 M Tris-HCl, pH 6.6, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.26 Å R-free 0.144
3UEO Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide Deposited 2011-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 549–746（198 aa） Fragment：BRCT domain Chain C 549–746（198 aa） Fragment：BRCT domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；PEG 10000, Ammonium acetate, bis-Tris, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.60 Å R-free 0.234
3UEO Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide Deposited 2011-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 549–746（198 aa） Fragment：BRCT domain Chain D 549–746（198 aa） Fragment：BRCT domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；PEG 10000, Ammonium acetate, bis-Tris, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.60 Å R-free 0.234
6RML Crystal structure of TOPBP1 BRCT0,1,2 in complex with a 53BP1 phosphopeptide Deposited 2019-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–290（290 aa） Chain B 1–290（290 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；287.15 K；10% w/v PEG 20 000 20% v/v PEG MME 550 0.03 M of each ethylene glycol 0.1 M MES/imidazole pH 6.5	Resolution 2.81 Å R-free 0.260
6RMM Crystal structure of TOPBP1 BRCT4,5 in complex with a 53BP1 phosphopeptide Deposited 2019-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 548–741（194 aa） Chain B 548–741（194 aa） Chain C 548–741（194 aa） Chain D 548–741（194 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；287.15 K；10% w/v PEG 4000, 20% v/v glycerol 0.02 M of each carboxylic acid 0.1 M MOPS/HEPES-Na pH 7.5	Resolution 3.53 Å R-free 0.234
7CMZ Crystal Structure of BRCT7/8 in Complex with the APS Motif of PHF8 Deposited 2020-07-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1264–1493（230 aa）	Not recorded	K POTASSIUM ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；289 K；Sodium phosphate monobasic monohydrate, Potassium phosphate dibasic	Resolution 1.70 Å R-free 0.215
9MAT TopBP1 BRCT 7-8 Domain Deposited 2025-03-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1264–1493（230 aa）	Not recorded	MLA MALONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.3 M Sodium malonate pH 7.0, 20% w/v PEG 3350	Resolution 1.65 Å R-free 0.207
9MAW Crystal structure of TOPBP1BRCT7-8 domain in complex with 1-Adamantaneacetic acid Deposited 2025-03-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1264–1491（228 aa）	Not recorded	A1ENP 1-Adamantylacetic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M Citric acid, 2.4 M Ammonium sulfate pH 5.0	Resolution 2.45 Å R-free 0.237

14 other PDB entries and 19 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TOPB1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–203； UniProt 549–746

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3uen
Deposition date deposition_date	2011-10-31
Structure title title	Crystal structure of TopBP1 BRCT4/5 domains
Keywords keywords	BRCT domain, phospho-peptide binding, PEPTIDE BINDING PROTEIN; PEPTIDE BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	20.08 Å
Radius of gyration Rg (electron density) rg_electron	19.07 Å
Forward intensity I(0) i0	8495740.00
Molecular weight molecular_weight	21889.0 kDa
Excluded volume excluded_volume	27620 Å³
Envelope volume envelope_volume	33529 Å³
Hydration-shell volume shell_volume	15492 Å³
Envelope diameter envelope_diameter	72.3 Å
Shell Rg shell_rg	24.25 Å
Envelope Rg envelope_rg	19.38 Å
Shape Rg shape_rg	19.03 Å
Total Rg total_rg	20.05 Å
Total atoms total_atoms	1535
Residues n_residues	195
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	76.6 Å
Rg (real space) rg_real	20.11 Å
Rg uncertainty (real space) rg_real_error	0.78 Å
I(0) (real space) i0_real	8.4960e+06
I(0) uncertainty (real space) i0_real_error	1.2100e+05
Rg (reciprocal space) rg_reciprocal	20.11 Å
I(0) (reciprocal space) i0_reciprocal	8496000.0000
Solution quality estimate total_estimate	0.8110
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	20.8 Å
Skewness Skewness skewness	0.358
Kurtosis Kurtosis kurtosis	-0.380
Angular range angular_range	— – 0.3950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1973000.0000
Real-space data points n_real_points	71
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.588; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.774; Smooth: 1.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	DNA topoisomerase 2-binding protein 1
Molecular weight formula_weight	22238.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1811

GPLGSEEGLFSQKSFLVLGFSNENESNIANIIKENAGKIMSLLSRTVADYAVVPLLGCEVEATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVISFSQCAGAEKESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKEER

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	THIOCYANATE ION
Molecular weight formula_weight	58.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	238

▼

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3uenA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	10190 — BRCT domain

Domain ID domain_id	3uenA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	10190 — BRCT domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	35.902 Å
Unit-cell length b length_b	48.801 Å
Unit-cell length c length_c	126.088 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 2 2 21
Space-group number int_tables_number	17
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	38.590 Å
R factor r_factor	0.1775
R_work r_work	0.1750
R_free r_free	0.2237

fit	/app/data/saxs_computation/ue/3uen/3uen.fit
pddf	/app/data/pr_computation/ue/3uen/3uen.pr.out
profile	/app/data/saxs_computation/ue/3uen/3uen.dat

Crystal structure of TopBP1 BRCT4/5 domains

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA topoisomerase 2-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction