SAXSdb — 4c9a

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E3 UBIQUITIN-PROTEIN LIGASE ZNRF3

MUS MUSCULUS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 1–165 Chain C； UniProt 1–165	Fragment：ECTODOMAIN, RESIDUES 1-165	R-SPONDIN-2 × 2 （Q5M7L6）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.40 Å R-free 0.273

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4C9A	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4C86 mouse ZNRF3 ectodomain crystal form I Deposited 2013-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205 Chain B 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å R-free 0.276
4C8A mouse ZNRF3 ectodomain crystal form II Deposited 2013-09-30	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å R-free 0.299
4C8A mouse ZNRF3 ectodomain crystal form II Deposited 2013-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205 Chain B 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å R-free 0.299
4C8C mouse ZNRF3 ectodomain crystal form III Deposited 2013-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205 Chain B 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å R-free 0.320
4C8F mouse ZNRF3 ectodomain crystal form IV Deposited 2013-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205 Chain D 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.69 Å R-free 0.341
4C8F mouse ZNRF3 ectodomain crystal form IV Deposited 2013-09-30	Different construct Different oligomeric state Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205 Chain C 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.69 Å R-free 0.341
4C8P mouse ZNRF3 ectodomain crystal form V, disulfide-bridged S90C variant Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.286
4C99 Mouse ZNRF3 ectodomain in complex with mouse RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-02	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205 Chain C 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.323
4C9E Mouse ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 (Seleno Met) crystal form II Deposited 2013-10-02	Different construct Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205 Chain C 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.334
4C9E Mouse ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 (Seleno Met) crystal form II Deposited 2013-10-02	Different construct Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205 Chain G 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.334
4CDJ Structure of ZNRF3 ectodomain Deposited 2013-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	EDO 1,2-ETHANEDIOL × 3 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions 0.2 M AMMONIUM FORMATE AT PH 6.6 WITH 20% W/V PEG3350	Resolution 1.50 Å R-free 0.177
4CDJ Structure of ZNRF3 ectodomain Deposited 2013-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions 0.2 M AMMONIUM FORMATE AT PH 6.6 WITH 20% W/V PEG3350	Resolution 1.50 Å R-free 0.177
4CDK Structure of ZNRF3-RSPO1 Deposited 2013-11-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2M SODIUM BROMIDE AND 20% W/V PEG 3350	Resolution 2.80 Å R-free 0.246
4CDK Structure of ZNRF3-RSPO1 Deposited 2013-11-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2M SODIUM BROMIDE AND 20% W/V PEG 3350	Resolution 2.80 Å R-free 0.246
4CDK Structure of ZNRF3-RSPO1 Deposited 2013-11-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2M SODIUM BROMIDE AND 20% W/V PEG 3350	Resolution 2.80 Å R-free 0.246
4CDK Structure of ZNRF3-RSPO1 Deposited 2013-11-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2M SODIUM BROMIDE AND 20% W/V PEG 3350	Resolution 2.80 Å R-free 0.246
4UFS Low resolution structure R-spondin-2 (Fu1Fu2) in complex with the ectodomains of LGR5 and ZNRF3 Deposited 2015-03-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 53–205（153 aa） Fragment：ECTODOMAIN, RESIDUES 53-205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；0.100 M AMMONIUM ACETATE, 0.600 M SODIUM CHLORIDE, 0.050 M MES PH 6.0, 0.005 M MAGNESIUM SULPHATE	Resolution 4.80 Å R-free 0.313

10 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ZNRF3_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–165； UniProt 1–165 Author chain C； PDBConstruct 1–165； UniProt 1–165

R-SPONDIN-2

XENOPUS (SILURANA) TROPICALIS

UniProt Q5M7L6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 32–152 Chain D； UniProt 35–144	Fragment：FU1-FU2, RESIDUES 32-152 Non-standard monomer：Yes (specific site not provided by mmCIF)	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3 × 2 （Q5SSZ7）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.40 Å R-free 0.273

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4C9A	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4C8V Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
4C8V Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
4C8V Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
4C8V Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
4C8V Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
4C8V Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
4C8V Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
4C8V Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.270
4C8W Xenopus RSPO2 Fu1-Fu2 crystal form II Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å R-free 0.313
4C8W Xenopus RSPO2 Fu1-Fu2 crystal form II Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain J 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.10 Å R-free 0.313
4C9E Mouse ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 (Seleno Met) crystal form II Deposited 2013-10-02	Different construct Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144 Chain D 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.334
4C9E Mouse ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 (Seleno Met) crystal form II Deposited 2013-10-02	Different construct Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144 Chain H 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.334
4C9R Xenopus ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 crystal form I Deposited 2013-10-02	Different construct Different mutation/modification Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144 Chain D 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.246
4C9U Xenopus ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 crystal form II Deposited 2013-10-03	Different construct Different mutation/modification Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.310
4C9U Xenopus ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 crystal form II Deposited 2013-10-03	Different construct Different mutation/modification Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.310
4C9V Xenopus RNF43 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 Deposited 2013-10-03	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 35–144（110 aa） Fragment：FU1-FU2, RESIDUES 35-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å R-free 0.395

6 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RSPO2_XENTR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–121； UniProt 32–152 Author chain D； PDBConstruct 4–113； UniProt 35–144

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4c9a
Deposition date deposition_date	2013-10-02
Structure title title	Mouse ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 (Seleno Met) crystal form I
Keywords keywords	LIGASE, WNT, LGR4, LGR5, LGR6, RSPO, R-SPONDIN, R-SPO, RSPO1, RSPO2, RSPO3, RSPO4, RECEPTOR, SIGNALLING; LIGASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	27.89 Å
Radius of gyration Rg (electron density) rg_electron	27.07 Å
Forward intensity I(0) i0	55304300.00
Molecular weight molecular_weight	54922.0 kDa
Excluded volume excluded_volume	67489 Å³
Envelope volume envelope_volume	91542 Å³
Hydration-shell volume shell_volume	28503 Å³
Envelope diameter envelope_diameter	88.5 Å
Shell Rg shell_rg	34.06 Å
Envelope Rg envelope_rg	27.14 Å
Shape Rg shape_rg	27.04 Å
Total Rg total_rg	27.88 Å
Total atoms total_atoms	3815
Residues n_residues	505
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	86.9 Å
Rg (real space) rg_real	27.82 Å
Rg uncertainty (real space) rg_real_error	0.61 Å
I(0) (real space) i0_real	5.5300e+07
I(0) uncertainty (real space) i0_real_error	8.1880e+05
Rg (reciprocal space) rg_reciprocal	27.84 Å
I(0) (reciprocal space) i0_reciprocal	55310000.0000
Solution quality estimate total_estimate	0.9103
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	27.4 Å
Skewness Skewness skewness	0.146
Kurtosis Kurtosis kurtosis	-0.741
Angular range angular_range	— – 0.2850 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6717000.0000
Real-space data points n_real_points	58
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.957; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.988; Smooth: 0.970

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
Molecular weight formula_weight	18203.6 kDa
EC 编号 ec_number	6.3.2.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	3815

ETGKETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLGTKHHHHHH

来源 Source

来源生物 organism	MUS MUSCULUS
通用名 common_name	HOUSE MOUSE
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	HOMO SAPIENS

Entity 2 Entity 2 polymer

Description description	R-SPONDIN-2
Molecular weight formula_weight	13922.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

ETGGTNPICKGCLSCSKDNGCLRCQPKLFFYLRREGMRQYGECLQSCPPGYYGVRGPDMNRCSRCRIENCDSCFSRDFCIKCKSGFYSHKGQCFEECPEGFAPLDDTMVCVDGTKHHHHHH

来源 Source

来源生物 organism	XENOPUS (SILURANA) TROPICALIS
通用名 common_name	WESTERN CLAWED FROG
NCBI Class编号 ncbi_taxonomy_id	8364
宿主生物 host_organism	HOMO SAPIENS

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4c9ab_
Class class	g — Small proteins
Fold Fold fold	g.3 — Knottins (small inhibitors, toxins, lectins)
Superfamily Superfamily superfamily	g.3.9 — Growth factor receptor domain
Family Family family	g.3.9.0 — automated matches

Domain ID domain_id	d4c9ad_
Class class	g — Small proteins
Fold Fold fold	g.3 — Knottins (small inhibitors, toxins, lectins)
Superfamily Superfamily superfamily	g.3.9 — Growth factor receptor domain
Family Family family	g.3.9.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	4c9aA00
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	30 — Glucose Oxidase; domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4c9aB00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	220 — Hormone Receptor, Insulin-like Growth Factor Receptor 1; Chain A domain 2
Homologous superfamily homologous superfamily	10 — Hormone Receptor, Insulin-like Growth Factor Receptor 1; Chain A, domain 2

Domain ID domain_id	4c9aC00
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	30 — Glucose Oxidase; domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	4c9aD00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	220 — Hormone Receptor, Insulin-like Growth Factor Receptor 1; Chain A domain 2
Homologous superfamily homologous superfamily	10 — Hormone Receptor, Insulin-like Growth Factor Receptor 1; Chain A, domain 2

▶

8. Citations (1)

▶

Unit-cell length a length_a	36.360 Å
Unit-cell length b length_b	70.957 Å
Unit-cell length c length_c	71.994 Å
Unit-cell angle α angle_alpha	109.15 °
Unit-cell angle β angle_beta	101.71 °
Unit-cell angle γ angle_gamma	101.30 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	38.920 Å
R factor r_factor	0.1988
R_work r_work	0.1948
R_free r_free	0.2729

fit	/app/data/saxs_computation/c9/4c9a/4c9a.fit
pddf	/app/data/pr_computation/c9/4c9a/4c9a.pr.out
profile	/app/data/saxs_computation/c9/4c9a/4c9a.dat

Mouse ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 (Seleno Met) crystal form I

1. Protein Identity and Related Structures Protein Identity & Related Structures

E3 UBIQUITIN-PROTEIN LIGASE ZNRF3

State in the Current Structure

Other States of the Same Protein in the Database

R-SPONDIN-2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)