4ckd

Model of complex between the E.coli enzyme beta-galactosidase and four single chain Fv antibody domains scFv13R4.

Method: ELECTRON MICROSCOPY D_max: 180.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

BETA-GALACTOSIDASE

ESCHERICHIA COLI K-12

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 1–1024 Chain B； UniProt 1–1024 Chain C； UniProt 1–1024 Chain D； UniProt 1–1024	Not recorded	SCFV13R4 ANTIBODY FV HEAVY CHAIN × 4 SCFV13R4 ANTIBODY FV LIGHT CHAIN × 4	ELECTRON MICROSCOPY cryo-EM buffer：20% PHOSPHATE BUFFERED SALINE (PBS)；pH 7.4；20% PHOSPHATE BUFFERED SALINE (PBS) cryo-EM vitrification conditions：Cryogen ETHANE；VITRIFICATION 1 -- CRYOGEN- ETHANE, HUMIDITY- 100, TEMPERATURE- 100, INSTRUMENT- OTHER, METHOD- BLOT FOR 10-20 SECONDS UNTIL DIAMETER OF BLOTTED MENISCUS CEASES TO EXPAND, BEFORE PLUNGING.	Resolution 13.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4CKD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DP0 E. COLI BETA-GALACTOSIDASE AT 1.7 ANGSTROM Deposited 1999-12-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 9–1023（1015 aa） Chain B 9–1023（1015 aa） Chain C 9–1023（1015 aa） Chain D 9–1023（1015 aa）	Not recorded	MG MAGNESIUM ION × 16 NA SODIUM ION × 20 DMS DIMETHYL SULFOXIDE × 112	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10 % PEG 8000 100 MM BIS-TRIS 200 MM MGCL(2) 100 MM NACL 10 MM DTT, pH 6.50, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 1.70 Å R-free 0.211
1F4A E. COLI (LACZ) BETA-GALACTOSIDASE (NCS CONSTRAINED MONOMER-ORTHORHOMBIC) Deposited 2000-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–1023（1021 aa） Chain B 3–1023（1021 aa） Chain C 3–1023（1021 aa） Chain D 3–1023（1021 aa）	Not recorded	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；10% PEG 2KMME, 100 mM Bis-Tris, 200 mM MgCl(2), 1 mM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.198
1F4H E. COLI (LACZ) BETA-GALACTOSIDASE (ORTHORHOMBIC) Deposited 2000-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–1023（1021 aa） Chain B 3–1023（1021 aa） Chain C 3–1023（1021 aa） Chain D 3–1023（1021 aa）	Not recorded	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；10 % PEG 2KMME, 100 mM Bis-Tris, 200 mM MgCl(2), 1 mM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.279
1HN1 E. COLI (LAC Z) BETA-GALACTOSIDASE (ORTHORHOMBIC) Deposited 2000-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 9–1023（1015 aa） Chain B 9–1023（1015 aa） Chain C 9–1023（1015 aa） Chain D 9–1023（1015 aa）	Not recorded	MG MAGNESIUM ION × 8 NA SODIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG 8000, 100 mM BIS TRIS, 200 mM MGCL(2), 100 mM NACL, 10 mM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 3.00 Å R-free 0.299
1JYN E. COLI (lacZ) BETA-GALACTOSIDASE (E537Q) IN COMPLEX WITH LACTOSE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Mutation：E537Q Mutation：E537Q Mutation：E537Q Mutation：E537Q	MG MAGNESIUM ION × 14 NA SODIUM ION × 15 DMS DIMETHYL SULFOXIDE × 96	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；PEG 8000, NaCl, MgCl2, DTT, Bis-Tris, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 1.80 Å R-free 0.219
1JYV E. COLI (lacZ) BETA-GALACTOSIDASE (E537Q) IN COMPLEX WITH ONPG Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Mutation：E537Q Mutation：E537Q Mutation：E537Q Mutation：E537Q	MG MAGNESIUM ION × 17 NA SODIUM ION × 16 145 2-nitrophenyl beta-D-galactopyranoside × 8 DMS DIMETHYL SULFOXIDE × 107	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；BIS-TRIS, PEG 8000, MGCL(2), NACL, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 1.75 Å R-free 0.240
1JYW E. COLI (lacZ) BETA-GALACTOSIDASE (E537Q) IN COMPLEX WITH PNPG Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Mutation：E537Q Mutation：E537Q Mutation：E537Q Mutation：E537Q	147 4-nitrophenyl beta-D-galactopyranoside × 4 MG MAGNESIUM ION × 15 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 109	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 1.55 Å R-free 0.229
1JYX E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH IPTG Deposited 2001-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Not recorded	MG MAGNESIUM ION × 9 NA SODIUM ION × 14 IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 6 DMS DIMETHYL SULFOXIDE × 74	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 1.75 Å R-free 0.244
1JZ2 E. COLI (lacZ) BETA-GALACTOSIDASE-TRAPPED 2-F-GALACTOSYL-ENZYME INTERMEDIATE (ORTHORHOMBIC) Deposited 2001-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Not recorded	2FG 2-deoxy-2-fluoro-beta-D-galactopyranose × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 12 DMS DIMETHYL SULFOXIDE × 69 BTB 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 2.10 Å R-free 0.270
1JZ3 E. COLI (lacZ) BETA-GALACTOSIDASE-TRAPPED 2-DEOXY-GALACTOSYL ENZYME INTERMEDIATE Deposited 2001-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Not recorded	2DG 2-deoxy-alpha-D-galactopyranose × 4 MG MAGNESIUM ION × 17 NA SODIUM ION × 16 BTB 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 4 DMS DIMETHYL SULFOXIDE × 110	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 1.75 Å R-free 0.222
1JZ4 E. COLI (lacZ) BETA-GALACTOSIDASE-TRAPPED 2-DEOXY-GALACTOSYL-ENZYME INTERMEDIATE (Low Bis-Tris) Deposited 2001-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Not recorded	2DG 2-deoxy-alpha-D-galactopyranose × 4 MG MAGNESIUM ION × 10 NA SODIUM ION × 15 DMS DIMETHYL SULFOXIDE × 103	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 2.10 Å R-free 0.267
1JZ5 E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ON Deposited 2001-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Not recorded	149 D-galactonolactone × 4 MG MAGNESIUM ION × 11 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 87	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 1.80 Å R-free 0.231
1JZ6 E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTO-TETRAZOLE Deposited 2001-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Not recorded	GTZ (5R, 6S, 7S, 8S)-5-HYDROXYMETHYL-6,7,8-TRIHYDROXY-TETRAZOLO[1,5-A]PIPERIDINE × 4 MG MAGNESIUM ION × 13 NA SODIUM ION × 11 DMS DIMETHYL SULFOXIDE × 74	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 2.10 Å R-free 0.270
1JZ7 E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	GAL beta-D-galactopyranose × 8 MG MAGNESIUM ION × 15 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 91	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 1.50 Å R-free 0.219
1JZ8 E. COLI (lacZ) BETA-GALACTOSIDASE (E537Q) IN COMPLEX WITH ALLOLACTOSE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Mutation：E537Q Mutation：E537Q Mutation：E537Q Mutation：E537Q	MG MAGNESIUM ION × 16 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 127 BGC beta-D-glucopyranose × 1 TAR D(-)-TARTARIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 1.50 Å R-free 0.208
1PX3 E. COLI (LACZ) BETA-GALACTOSIDASE (G794A) Deposited 2003-07-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 9–1023（1015 aa） Chain B 9–1023（1015 aa） Chain C 9–1023（1015 aa） Chain D 9–1023（1015 aa）	Mutation：G794A Mutation：G794A Mutation：G794A Mutation：G794A	MG MAGNESIUM ION × 12 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 85	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；PEG 8000, NACL, MGCL2, DTT, BIS-TRIS, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 1.60 Å R-free 0.243
1PX4 E. COLI (LACZ) BETA-GALACTOSIDASE (G794A) WITH IPTG BOUND Deposited 2003-07-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 9–1023（1015 aa） Chain B 9–1023（1015 aa） Chain C 9–1023（1015 aa） Chain D 9–1023（1015 aa）	Mutation：G794A Mutation：G794A Mutation：G794A Mutation：G794A	MG MAGNESIUM ION × 16 NA SODIUM ION × 16 IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 4 DMS DIMETHYL SULFOXIDE × 94	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；PEG 8000, NACL, MGCL2, DTT, BIS-TRIS, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 1.60 Å R-free 0.239
28YO Beta-galactosidase from E.Coli Deposited 2026-03-02	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Mutation：F1008L Mutation：F1008L Mutation：F1008L Mutation：F1008L	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.48 Å
3CZJ E. COLI (lacZ) BETA-GALACTOSIDASE (N460T) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE Deposited 2008-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N461T Mutation：N461T Mutation：N461T	149 D-galactonolactone × 3 MG MAGNESIUM ION × 7 NA SODIUM ION × 12 DMS DIMETHYL SULFOXIDE × 69	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；PEG 8000, NaCl, MgCl2, DTT, Bis-Tris, pH 6.5, HANGING DROP at 288K, pH 6.50, VAPOR DIFFUSION, HANGING DROP	Resolution 2.05 Å R-free 0.231
3CZJ E. COLI (lacZ) BETA-GALACTOSIDASE (N460T) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE Deposited 2008-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N461T Mutation：N461T Mutation：N461T Mutation：N461T	149 D-galactonolactone × 4 MG MAGNESIUM ION × 9 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 94	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；PEG 8000, NaCl, MgCl2, DTT, Bis-Tris, pH 6.5, HANGING DROP at 288K, pH 6.50, VAPOR DIFFUSION, HANGING DROP	Resolution 2.05 Å R-free 0.231
3DYM E. coli (lacZ) beta-galactosidase (H418E) Deposited 2008-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：H418E Mutation：H418E Mutation：H418E Mutation：H418E	MG MAGNESIUM ION × 10 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 82	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.05 Å R-free 0.251
3DYO E. coli (lacZ) beta-galactosidase (H418N) in complex with IPTG Deposited 2008-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：H418N Mutation：H418N Mutation：H418N Mutation：H418N	MG MAGNESIUM ION × 14 NA SODIUM ION × 18 IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 12 DMS DIMETHYL SULFOXIDE × 97	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 1.80 Å R-free 0.241
3DYP E. coli (lacZ) beta-galactosidase (H418N) Deposited 2008-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：H418N Mutation：H418N Mutation：H418N Mutation：H418N	MG MAGNESIUM ION × 16 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 107	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 1.75 Å R-free 0.217
3E1F E.Coli (lacZ) beta-galactosidase (H418E) in complex with galactose Deposited 2008-08-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 10–1024（1015 aa） Fragment：BETA-GALACTOSIDASE Chain 2 10–1024（1015 aa） Fragment：BETA-GALACTOSIDASE Chain 3 10–1024（1015 aa） Fragment：BETA-GALACTOSIDASE Chain 4 10–1024（1015 aa） Fragment：BETA-GALACTOSIDASE	Mutation：H418E Mutation：H418E Mutation：H418E Mutation：H418E	MG MAGNESIUM ION × 10 NA SODIUM ION × 13 DMS DIMETHYL SULFOXIDE × 73 GAL beta-D-galactopyranose × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；Bis-Tris, PEG 8000, MgCl2, NaCl, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 288K, pH 6.50	Resolution 3.00 Å R-free 0.249
3J7H Structure of beta-galactosidase at 3.2-A resolution obtained by cryo-electron microscopy Deposited 2014-06-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer 25 mM Tris, pH 8.0, 50 mM NaCl, 2 mM MgCl2, 0.5 mM TCEP；pH 8；25 mM Tris, pH 8.0, 50 mM NaCl, 2 mM MgCl2, 0.5 mM TCEP cryo-EM vitrification conditions Blot for 2 seconds before plunging.；90.15 K；Cryogen ETHANE；Blot for 2 seconds before plunging into liquid ethane (LEICA EM GP).	Resolution 3.20 Å
3SEP E. coli (lacZ) beta-galactosidase (S796A) Deposited 2011-06-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796A Mutation：S796A Mutation：S796A Mutation：S796A	MG MAGNESIUM ION × 9 NA SODIUM ION × 14 DMS DIMETHYL SULFOXIDE × 78	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 2.05 Å R-free 0.221
3T08 E. coli (LacZ) beta-galactosidase (S796A) IPTG complex Deposited 2011-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796A Mutation：S796A Mutation：S796A Mutation：S796A	MG MAGNESIUM ION × 9 NA SODIUM ION × 13 IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 4 DMS DIMETHYL SULFOXIDE × 71	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 2.00 Å R-free 0.223
3T09 E. coli (LacZ) beta-galactosidase (S796A) galactonolactone complex Deposited 2011-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796A Mutation：S796A Mutation：S796A Mutation：S796A	149 D-galactonolactone × 4 MG MAGNESIUM ION × 11 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 107	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 1.75 Å R-free 0.254
3T0A E. coli (LacZ) beta-galactosidase (S796T) Deposited 2011-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796T Mutation：S796T Mutation：S796T Mutation：S796T	MG MAGNESIUM ION × 12 NA SODIUM ION × 17 DMS DIMETHYL SULFOXIDE × 110	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 1.90 Å R-free 0.214
3T0B E. coli (LacZ) beta-galactosidase (S796T) IPTG complex Deposited 2011-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796T Mutation：S796T Mutation：S796T Mutation：S796T	MG MAGNESIUM ION × 8 NA SODIUM ION × 14 IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 4 DMS DIMETHYL SULFOXIDE × 69	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 2.40 Å R-free 0.233
3T0D E.coli (lacZ) beta-galactosidase (S796T) in complex with galactonolactone Deposited 2011-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796T Mutation：S796T Mutation：S796T Mutation：S796T	149 D-galactonolactone × 4 MG MAGNESIUM ION × 9 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 104	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 mM Bis-tris, 200 mM MgCl2, 100 mM NaCl, 10 mM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 1.93 Å R-free 0.209
3T2O E. coli (lacZ) beta-galactosidase (S796D) Deposited 2011-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796D Mutation：S796D Mutation：S796D Mutation：S796D	MG MAGNESIUM ION × 16 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 112	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 1.85 Å R-free 0.182
3T2P E. coli (lacZ) beta-galactosidase (S796D) in complex with IPTG Deposited 2011-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796D Mutation：S796D Mutation：S796D Mutation：S796D	IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 10 DMS DIMETHYL SULFOXIDE × 63	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 2.60 Å R-free 0.242
3T2Q E. coli (lacZ) beta-galactosidase (S796D) in complex with galactonolactone Deposited 2011-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：Unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：Unp residues 10-1024	Mutation：S796D Mutation：S796D Mutation：S796D Mutation：S796D	149 D-galactonolactone × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 11 DMS DIMETHYL SULFOXIDE × 49	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；8-10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288.0K	Resolution 2.40 Å R-free 0.239
3VD3 E. coli (lacZ) beta-galactosidase (N460D) Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N460D Mutation：N460D Mutation：N460D Mutation：N460D	MG MAGNESIUM ION × 7 NA SODIUM ION × 12 DMS DIMETHYL SULFOXIDE × 45	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG8000, 100 mM Bis-Tris, pH 6.5, 200 mM magnesium chloride, 100 mM sodium chloride, 10 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.80 Å R-free 0.282
3VD4 E. coli (lacZ) beta-galactosidase (N460D) in complex with IPTG Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N460D Mutation：N460D Mutation：N460D Mutation：N460D	MG MAGNESIUM ION × 9 NA SODIUM ION × 14 DMS DIMETHYL SULFOXIDE × 68 IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG8000, 100 mM Bis-Tris, pH 6.5, 200 mM magnesium chloride, 100 mM sodium chloride, 10 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.00 Å R-free 0.212
3VD5 E. coli (lacZ) beta-galactosidase (N460S) Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N460S Mutation：N460S Mutation：N460S Mutation：N460S	MG MAGNESIUM ION × 8 NA SODIUM ION × 11 DMS DIMETHYL SULFOXIDE × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG8000, 100 mM Bis-Tris, pH 6.5, 200 mM magnesium chloride, 100 mM sodium chloride, 10 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.70 Å R-free 0.276
3VD7 E. coli (lacZ) beta-galactosidase (N460S) in complex with galactotetrazole Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N460S Mutation：N460S Mutation：N460S Mutation：N460S	GTZ (5R, 6S, 7S, 8S)-5-HYDROXYMETHYL-6,7,8-TRIHYDROXY-TETRAZOLO[1,5-A]PIPERIDINE × 4 MG MAGNESIUM ION × 6 NA SODIUM ION × 8 DMS DIMETHYL SULFOXIDE × 29	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG8000, 100 mM Bis-Tris, pH 6.5, 200 mM magnesium chloride, 100 mM sodium chloride, 10 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.87 Å R-free 0.250
3VD9 E. coli (lacZ) beta-galactosidase (N460S) in complex with IPTG Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N460S Mutation：N460S Mutation：N460S Mutation：N460S	MG MAGNESIUM ION × 9 NA SODIUM ION × 16 IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 4 DMS DIMETHYL SULFOXIDE × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG8000, 100 mM Bis-Tris, pH 6.5, 200 mM magnesium chloride, 100 mM sodium chloride, 10 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.05 Å R-free 0.223
3VDA E. coli (lacZ) beta-galactosidase (N460T) Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N460T Mutation：N460T Mutation：N460T Mutation：N460T	MG MAGNESIUM ION × 8 NA SODIUM ION × 10 DMS DIMETHYL SULFOXIDE × 32	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG8000, 100 mM Bis-Tris, pH 6.5, 200 mM magnesium chloride, 100 mM sodium chloride, 10 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.50 Å R-free 0.237
3VDB E. coli (lacZ) beta-galactosidase (N460T) in complex with galactonolactone Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N460T Mutation：N460T Mutation：N460T Mutation：N460T	149 D-galactonolactone × 4 MG MAGNESIUM ION × 9 NA SODIUM ION × 14 DMS DIMETHYL SULFOXIDE × 77	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG8000, 100 mM Bis-Tris, pH 6.5, 200 mM magnesium chloride, 100 mM sodium chloride, 10 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.05 Å R-free 0.205
3VDC E. coli (lacZ) beta-galactosidase (N460T) in complex with IPTG Deposited 2012-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Chain B 10–1024（1015 aa） Chain C 10–1024（1015 aa） Chain D 10–1024（1015 aa）	Mutation：N460T Mutation：N460T Mutation：N460T Mutation：N460T	IPT 1-methylethyl 1-thio-beta-D-galactopyranoside × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 10 DMS DIMETHYL SULFOXIDE × 46	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG8000, 100 mM Bis-Tris, pH 6.5, 200 mM magnesium chloride, 100 mM sodium chloride, 10 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.55 Å R-free 0.236
4DUV E. coli (lacZ) beta-galactosidase (G974A) 2-deoxy-galactosyl-enzyme and bis-Tris complex Deposited 2012-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：unp residues 10-1024	Mutation：G794A Mutation：G794A Mutation：G794A Mutation：G794A	2DG 2-deoxy-alpha-D-galactopyranose × 4 BTB 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 4 MG MAGNESIUM ION × 9 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 90	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.10 Å R-free 0.206
4DUW E. coli (lacZ) beta-galactosidase (G974A) in complex with allolactose Deposited 2012-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：unp residues 10-1024	Mutation：G794A Mutation：G794A Mutation：G794A Mutation：G794A	MG MAGNESIUM ION × 10 NA SODIUM ION × 16 DMS DIMETHYL SULFOXIDE × 77	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT , pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.20 Å R-free 0.213
4DUX E. coli (lacZ) beta-galactosidase (N460S) in complex with L-ribose Deposited 2012-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain B 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain C 10–1024（1015 aa） Fragment：unp residues 10-1024 Chain D 10–1024（1015 aa） Fragment：unp residues 10-1024	Mutation：N460S Mutation：N460S Mutation：N460S Mutation：N460S	0MK beta-L-ribopyranose × 9 MG MAGNESIUM ION × 8 NA SODIUM ION × 14 DMS DIMETHYL SULFOXIDE × 65	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；288 K；10% PEG 8000, 100 MM BIS-TRIS, 200 MM MGCL2, 100 MM NACL, 10 MM DTT , pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.30 Å R-free 0.221
4V40 BETA-GALACTOSIDASE Deposited 1994-07-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Not recorded	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
4V40 BETA-GALACTOSIDASE Deposited 1994-07-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 1–1023（1023 aa） Chain F 1–1023（1023 aa） Chain G 1–1023（1023 aa） Chain H 1–1023（1023 aa）	Not recorded	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
4V40 BETA-GALACTOSIDASE Deposited 1994-07-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain I 1–1023（1023 aa） Chain J 1–1023（1023 aa） Chain K 1–1023（1023 aa） Chain L 1–1023（1023 aa）	Not recorded	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
4V40 BETA-GALACTOSIDASE Deposited 1994-07-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain M 1–1023（1023 aa） Chain N 1–1023（1023 aa） Chain O 1–1023（1023 aa） Chain P 1–1023（1023 aa）	Not recorded	MG MAGNESIUM ION × 7	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
4V41 E. COLI (LAC Z) BETA-GALACTOSIDASE (NCS CONSTRAINED MONOMER-MONOCLINIC) Deposited 2000-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；293 K；PEG 8000, Cacodylate, pH 5.9, VAPOR DIFFUSION, HANGING DROP, temperature 20K	Resolution 2.50 Å R-free 0.207
4V41 E. COLI (LAC Z) BETA-GALACTOSIDASE (NCS CONSTRAINED MONOMER-MONOCLINIC) Deposited 2000-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 1–1023（1023 aa） Chain F 1–1023（1023 aa） Chain G 1–1023（1023 aa） Chain H 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；293 K；PEG 8000, Cacodylate, pH 5.9, VAPOR DIFFUSION, HANGING DROP, temperature 20K	Resolution 2.50 Å R-free 0.207
4V41 E. COLI (LAC Z) BETA-GALACTOSIDASE (NCS CONSTRAINED MONOMER-MONOCLINIC) Deposited 2000-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain I 1–1023（1023 aa） Chain J 1–1023（1023 aa） Chain K 1–1023（1023 aa） Chain L 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；293 K；PEG 8000, Cacodylate, pH 5.9, VAPOR DIFFUSION, HANGING DROP, temperature 20K	Resolution 2.50 Å R-free 0.207
4V41 E. COLI (LAC Z) BETA-GALACTOSIDASE (NCS CONSTRAINED MONOMER-MONOCLINIC) Deposited 2000-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain M 1–1023（1023 aa） Chain N 1–1023（1023 aa） Chain O 1–1023（1023 aa） Chain P 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；293 K；PEG 8000, Cacodylate, pH 5.9, VAPOR DIFFUSION, HANGING DROP, temperature 20K	Resolution 2.50 Å R-free 0.207
4V44 E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH 2-F-LACTOSE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 8 NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；295 K；Cacodylate, PEG 8000, MgSO4, NaCl, BME, pH 5.9, VAPOR DIFFUSION, HANGING DROP at 295K, pH 5.90	Resolution 2.70 Å
4V44 E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH 2-F-LACTOSE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 1–1023（1023 aa） Chain F 1–1023（1023 aa） Chain G 1–1023（1023 aa） Chain H 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 8 NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；295 K；Cacodylate, PEG 8000, MgSO4, NaCl, BME, pH 5.9, VAPOR DIFFUSION, HANGING DROP at 295K, pH 5.90	Resolution 2.70 Å
4V44 E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH 2-F-LACTOSE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain I 1–1023（1023 aa） Chain J 1–1023（1023 aa） Chain K 1–1023（1023 aa） Chain L 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 8 NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；295 K；Cacodylate, PEG 8000, MgSO4, NaCl, BME, pH 5.9, VAPOR DIFFUSION, HANGING DROP at 295K, pH 5.90	Resolution 2.70 Å
4V44 E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH 2-F-LACTOSE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain M 1–1023（1023 aa） Chain N 1–1023（1023 aa） Chain O 1–1023（1023 aa） Chain P 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 8 NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；295 K；Cacodylate, PEG 8000, MgSO4, NaCl, BME, pH 5.9, VAPOR DIFFUSION, HANGING DROP at 295K, pH 5.90	Resolution 2.70 Å
4V45 E. COLI (lacZ) BETA-GALACTOSIDASE-TRAPPED 2-F-GALACTOSYL-ENZYME INTERMEDIATE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1023（1023 aa） Chain B 1–1023（1023 aa） Chain C 1–1023（1023 aa） Chain D 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	2FG 2-deoxy-2-fluoro-beta-D-galactopyranose × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；295 K；Cacodylate, PEG 8000, MgSO4, NaCl, BME, pH 5.9, VAPOR DIFFUSION, HANGING DROP at 295K, pH 5.90	Resolution 2.60 Å
4V45 E. COLI (lacZ) BETA-GALACTOSIDASE-TRAPPED 2-F-GALACTOSYL-ENZYME INTERMEDIATE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 1–1023（1023 aa） Chain F 1–1023（1023 aa） Chain G 1–1023（1023 aa） Chain H 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	2FG 2-deoxy-2-fluoro-beta-D-galactopyranose × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；295 K；Cacodylate, PEG 8000, MgSO4, NaCl, BME, pH 5.9, VAPOR DIFFUSION, HANGING DROP at 295K, pH 5.90	Resolution 2.60 Å
4V45 E. COLI (lacZ) BETA-GALACTOSIDASE-TRAPPED 2-F-GALACTOSYL-ENZYME INTERMEDIATE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain I 1–1023（1023 aa） Chain J 1–1023（1023 aa） Chain K 1–1023（1023 aa） Chain L 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	2FG 2-deoxy-2-fluoro-beta-D-galactopyranose × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；295 K；Cacodylate, PEG 8000, MgSO4, NaCl, BME, pH 5.9, VAPOR DIFFUSION, HANGING DROP at 295K, pH 5.90	Resolution 2.60 Å
4V45 E. COLI (lacZ) BETA-GALACTOSIDASE-TRAPPED 2-F-GALACTOSYL-ENZYME INTERMEDIATE Deposited 2001-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain M 1–1023（1023 aa） Chain N 1–1023（1023 aa） Chain O 1–1023（1023 aa） Chain P 1–1023（1023 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	2FG 2-deoxy-2-fluoro-beta-D-galactopyranose × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.9；295 K；Cacodylate, PEG 8000, MgSO4, NaCl, BME, pH 5.9, VAPOR DIFFUSION, HANGING DROP at 295K, pH 5.90	Resolution 2.60 Å
5A1A 2.2 A resolution cryo-EM structure of beta-galactosidase in complex with a cell-permeant inhibitor Deposited 2015-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–1024（1022 aa） Chain B 3–1024（1022 aa） Chain C 3–1024（1022 aa） Chain D 3–1024（1022 aa）	Not recorded	PTQ 2-phenylethyl 1-thio-beta-D-galactopyranoside × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer 25 MM TRIS, PH 8.0, 50 MM NACL, 2 MM MGCL2, 0.5 MM TCEP；pH 8；25 MM TRIS, PH 8.0, 50 MM NACL, 2 MM MGCL2, 0.5 MM TCEP cryo-EM vitrification conditions Cryogen ETHANE；BLOT FOR 2 SECONDS BEFORE PLUNGING INTO LIQUID ETHANE (LEICA EM GP).	Resolution 2.20 Å
6CVM Atomic resolution cryo-EM structure of beta-galactosidase Deposited 2018-03-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–1023（1021 aa） Chain B 3–1023（1021 aa） Chain C 3–1023（1021 aa） Chain D 3–1023（1021 aa）	Not recorded	PTQ 2-phenylethyl 1-thio-beta-D-galactopyranoside × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8；25 mM Tris, pH 8.0, 50 mM NaCl, 2 mM MgCl2, 1.0 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE；Blot for 2 seconds before plunging.	Resolution 1.90 Å
6DRV Beta-galactosidase Deposited 2018-06-13	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
6KUZ E.coli beta-galactosidase (E537Q) in complex with fluorescent probe KSL01 Deposited 2019-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa）	Mutation：E537Q Mutation：E537Q	DVL 3-(1,3-benzothiazol-2-yl)-2-[[4-[(2~{S},3~{R},4~{S},5~{R},6~{R})-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]methoxy]-5-methyl-benzaldehyde × 4 NA SODIUM ION × 12 DMS DIMETHYL SULFOXIDE × 42 MG MAGNESIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；291 K；10% PEG8000, 100mM Bis-Tris ph5,9, 200mM Nacl, 10mM DTT, 0.1M Guanidine Hydrochloride 10% glycerol	Resolution 2.83 Å R-free 0.224
6KUZ E.coli beta-galactosidase (E537Q) in complex with fluorescent probe KSL01 Deposited 2019-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Mutation：E537Q Mutation：E537Q	DVL 3-(1,3-benzothiazol-2-yl)-2-[[4-[(2~{S},3~{R},4~{S},5~{R},6~{R})-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]methoxy]-5-methyl-benzaldehyde × 4 NA SODIUM ION × 12 DMS DIMETHYL SULFOXIDE × 28 MG MAGNESIUM ION × 8 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；291 K；10% PEG8000, 100mM Bis-Tris ph5,9, 200mM Nacl, 10mM DTT, 0.1M Guanidine Hydrochloride 10% glycerol	Resolution 2.83 Å R-free 0.224
6X1Q 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope Deposited 2020-05-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–1023（1021 aa） Chain B 3–1023（1021 aa） Chain C 3–1023（1021 aa） Chain D 3–1023（1021 aa）	Not recorded	MG MAGNESIUM ION × 8 NA SODIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8；25mM Tris pH 8.0, 50mM NaCl, 0.5mM TCEP, 2mM MgCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.80 Å
7BRS E.coli beta-galactosidase (E537Q) in complex with fluorescent probe KSA02 Deposited 2020-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain C 1–1024（1024 aa）	Mutation：E537Q Mutation：E537Q	F4X 8-[2-[(E)-2-[4-[(2S,3R,4S,5R,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]ethenyl]-3,3-dimethyl-indol-1-ium-1-yl]octanoic acid × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 6 DMS DIMETHYL SULFOXIDE × 54 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；100mM Bis-Tris, pH=5.9, 200mM NaCl, 200mM MgCl2, 10% PEG8000, 10% glycerol, 0.1M guanidine hydrochloride, 10mM DTT	Resolution 2.67 Å R-free 0.244
7BRS E.coli beta-galactosidase (E537Q) in complex with fluorescent probe KSA02 Deposited 2020-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain B 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Mutation：E537Q Mutation：E537Q	F4X 8-[2-[(E)-2-[4-[(2S,3R,4S,5R,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]ethenyl]-3,3-dimethyl-indol-1-ium-1-yl]octanoic acid × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8 DMS DIMETHYL SULFOXIDE × 38	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；100mM Bis-Tris, pH=5.9, 200mM NaCl, 200mM MgCl2, 10% PEG8000, 10% glycerol, 0.1M guanidine hydrochloride, 10mM DTT	Resolution 2.67 Å R-free 0.244
7BTK E.coli beta-galactosidase (E537Q) in complex with fluorescent probe KSA01 Deposited 2020-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain C 1–1024（1024 aa）	Mutation：E537Q Mutation：E537Q	F6L 4-[[2-[(E)-2-[4-[(2S,3R,4S,5R,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]ethenyl]-3,3-dimethyl-2H-indol-1-yl]methyl]benzoic acid × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8 DMS DIMETHYL SULFOXIDE × 40	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；100 mM Bis-Tris, pH = 5.9, 200 mM NaCl, 200 mM MgCl2, 10% PEG8000, 10% glycerol, 0.1 M guanidine hydrochloride and 10 mM DTT	Resolution 2.70 Å R-free 0.233
7BTK E.coli beta-galactosidase (E537Q) in complex with fluorescent probe KSA01 Deposited 2020-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain B 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Mutation：E537Q Mutation：E537Q	F6L 4-[[2-[(E)-2-[4-[(2S,3R,4S,5R,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]ethenyl]-3,3-dimethyl-2H-indol-1-yl]methyl]benzoic acid × 4 MG MAGNESIUM ION × 6 NA SODIUM ION × 6 DMS DIMETHYL SULFOXIDE × 36 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；100 mM Bis-Tris, pH = 5.9, 200 mM NaCl, 200 mM MgCl2, 10% PEG8000, 10% glycerol, 0.1 M guanidine hydrochloride and 10 mM DTT	Resolution 2.70 Å R-free 0.233
8BK7 Cryo-EM structure of beta-galactosidase at 3.3 A resolution plunged 5 ms after mixing with apoferritin Deposited 2022-11-08	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；contains Amaranth dye (acid red 27) 32 mM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8BK8 Cryo-EM structure of beta-galactosidase at 2.9 A resolution plunged 205 ms after mixing with apoferritin Deposited 2022-11-08	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；contains Amaranth dye (acid red 27) 32 mM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8BKG Cryo-EM structure of beta-galactosidase at 3.2 A resolution plunged 35 ms after mixing with apoferritin Deposited 2022-11-09	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；contains Amaranth dye (acid red 27) 32 mM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8Q7Y ESIBD structure of beta-galactosidase Deposited 2023-08-17	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9；Soft-landed sample cryo-EM vitrification conditions Cryogen OTHER；Soft-landed as described in manuscript	Resolution 2.60 Å
8RI6 Beta-galactosidase (LacZ) purified from E. coli. Deposited 2023-12-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	MG MAGNESIUM ION × 8 NA SODIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8；25 mM Tris, 50 mM NaCl, 2 mM MgCl2, 2 mM EDTA, 1 mM TCEP, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å
8RI7 Beta-galactosidase (LacZ) in complex with glycosyrin from Pseudomonas syringae. Deposited 2023-12-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	A1H05 (2S,3R,4S)-2-[bis(oxidanyl)methyl]pyrrolidine-3,4-diol × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8；25 mM Tris, 50 mM NaCl, 2 mM MgCl2, 2 mM EDTA, 1 mM TCEP, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.93 Å
8RI8 Beta-galactosidase (LacZ) in complex with synthetic glycosyrin. Deposited 2023-12-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	A1H05 (2S,3R,4S)-2-[bis(oxidanyl)methyl]pyrrolidine-3,4-diol × 4 MG MAGNESIUM ION × 8 NA SODIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8；25 mM Tris, 50 mM NaCl, 2 mM MgCl2, 2 mM EDTA, 1 mM TCEP, pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.42 Å
9HKI Plunge-frozen beta-galactosidase Deposited 2024-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–1023（1021 aa） Chain B 3–1023（1021 aa） Chain C 3–1023（1021 aa） Chain D 3–1023（1021 aa）	Not recorded	MG MAGNESIUM ION × 4 NA SODIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；25 mM Tris (pH 7.9), 50 mM NaCl, 10 mM EDTA, and 2 mM MgCl2 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 1.90 Å
9HLM Soft-landed and rehydrated beta-galactosidase (best particles) Deposited 2024-12-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–1023（1021 aa） Chain B 3–1023（1021 aa） Chain C 3–1023（1021 aa） Chain D 3–1023（1021 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7	Resolution 3.70 Å
9HPL E. coli beta-galactosidase labeled with Chromeo P503 dye purified using MISO Deposited 2024-12-13	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；25 mM HEPES pH 8.0, 100 mM NaCl, 500 mM imidazole and 1mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.30 Å
9HPM E. coli beta-galactosidase labeled with Chromeo P503 dye purified using MISO from 1ug Deposited 2024-12-13	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；25 mM HEPES pH 8.0, 100 mM NaCl, 500 mM imidazole and 1mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
9Y45 His-tagged beta galactosidase (LacZ) on a Ni-NTA lipid monolayer grid Deposited 2025-09-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1024（1024 aa） Chain B 1–1024（1024 aa） Chain C 1–1024（1024 aa） Chain D 1–1024（1024 aa）	Not recorded	MG MAGNESIUM ION × 8 NA SODIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.41 Å

67 other PDB entries and 83 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BGAL_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1024； UniProt 1–1024 Author chain B； PDBConstruct 1–1024； UniProt 1–1024 Author chain C； PDBConstruct 1–1024； UniProt 1–1024 Author chain D； PDBConstruct 1–1024； UniProt 1–1024

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ckd
Deposition date deposition_date	2014-01-03
Structure title title	Model of complex between the E.coli enzyme beta-galactosidase and four single chain Fv antibody domains scFv13R4.
Keywords keywords	HYDROLASE-IMMUNE SYSTEM COMPLEX; HYDROLASE/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	55.98 Å
Radius of gyration Rg (electron density) rg_electron	55.58 Å
Forward intensity I(0) i0	4657390000.00
Molecular weight molecular_weight	561850.0 kDa
Excluded volume excluded_volume	696070 Å³
Envelope volume envelope_volume	920180 Å³
Hydration-shell volume shell_volume	131270 Å³
Envelope diameter envelope_diameter	184.1 Å
Shell Rg shell_rg	63.08 Å
Envelope Rg envelope_rg	54.81 Å
Shape Rg shape_rg	55.54 Å
Total Rg total_rg	55.87 Å
Total atoms total_atoms	39672
Residues n_residues	4968
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	180.3 Å
Rg (real space) rg_real	55.74 Å
Rg uncertainty (real space) rg_real_error	1.21 Å
I(0) (real space) i0_real	4.6570e+09
I(0) uncertainty (real space) i0_real_error	9.2840e+07
Rg (reciprocal space) rg_reciprocal	56.16 Å
I(0) (reciprocal space) i0_reciprocal	4660000000.0000
Solution quality estimate total_estimate	0.8832
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	77.3 Å
Skewness Skewness skewness	0.141
Kurtosis Kurtosis kurtosis	-0.511
Angular range angular_range	— – 0.1400 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	4278000000.0000
Real-space data points n_real_points	29
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.895; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.977; Smooth: 0.816

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	BETA-GALACTOSIDASE
Molecular weight formula_weight	116602.5 kDa
EC 编号 ec_number	3.2.1.23
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	39832

MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQWRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK

来源 Source

来源生物 organism	ESCHERICHIA COLI K-12
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	SCFV13R4 ANTIBODY FV HEAVY CHAIN
Molecular weight formula_weight	12795.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,K

DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA

来源 Source

来源生物 organism	MUS MUSCULUS
通用名 common_name	HOUSE MOUSE
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 polymer

Description description	SCFV13R4 ANTIBODY FV LIGHT CHAIN
Molecular weight formula_weight	11624.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,N,O

DIVLTQSPATLSVTPGNSVSLSCRASQSIGNDLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK

来源 Source

来源生物 organism	MUS MUSCULUS
通用名 common_name	HOUSE MOUSE
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	ESCHERICHIA COLI

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	13.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	13.00 Å
Resolution测定方法 resolution_method	PROJECTION MATCHING
颗粒数 num_particles	2965

fit	/app/data/saxs_computation/ck/4ckd/4ckd.fit
pddf	/app/data/pr_computation/ck/4ckd/4ckd.pr.out
profile	/app/data/saxs_computation/ck/4ckd/4ckd.dat

Model of complex between the E.coli enzyme beta-galactosidase and four single chain Fv antibody domains scFv13R4.

1. Protein Identity and Related Structures Protein Identity & Related Structures

BETA-GALACTOSIDASE

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)