SAXSdb — 4drw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein S100-A10/Annexin A2 chimeric protein

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3	Neuroblast differentiation-associated protein AHNAK × 1 （Q09666）	Consistent with protein count
2	Insufficient information	Heteromer	Protein 3	Neuroblast differentiation-associated protein AHNAK × 1 （Q09666）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANXA2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 107–121； UniProt 2–16 Author chain B； PDBConstruct 107–121； UniProt 2–16 Author chain C； PDBConstruct 107–121； UniProt 2–16 Author chain D； PDBConstruct 107–121； UniProt 2–16

Protein S100-A10/Annexin A2 chimeric protein

Homo sapiens

UniProt P60903

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3	Neuroblast differentiation-associated protein AHNAK × 1 （Q09666）	Consistent with protein count
2	Insufficient information	Heteromer	Protein 3	Neuroblast differentiation-associated protein AHNAK × 1 （Q09666）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S10AA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–98； UniProt 1–93 Author chain B； PDBConstruct 6–98； UniProt 1–93 Author chain C； PDBConstruct 6–98； UniProt 1–93 Author chain D； PDBConstruct 6–98； UniProt 1–93

Neuroblast differentiation-associated protein AHNAK

OrganismNot specified

UniProt Q09666

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3	Protein S100-A10/Annexin A2 chimeric protein × 2 （P07355,P60903）	Consistent with protein count
2	Insufficient information	Heteromer	Protein 3	Protein S100-A10/Annexin A2 chimeric protein × 2 （P07355,P60903）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AHNK_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–20； UniProt 5654–5673 Author chain F； PDBConstruct 1–20； UniProt 5654–5673

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4drw
Deposition date deposition_date	2012-02-17
Structure title title	Crystal Structure of the Ternary Complex between S100A10, an Annexin A2 N-terminal Peptide and an AHNAK Peptide
Keywords keywords	ATYPICAL EF-HAND, HETEROPENTAMERIC COMPLEX, MEMBRANE REPAIR, EXOCYTOSIS-PROTEIN BINDING complex; EXOCYTOSIS/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4drw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4drw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4drw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.45 Å
Rg (electron density)	17.30 Å
Total Rg	18.32 Å
Atom count	1745
Residues	217
Excluded volume	31556 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4drw__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4drw__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Protein S100-A10/Annexin A2 chimeric protein
Molecular weight formula_weight	13765.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	3490

GPLGSMPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQENLYFQGDSTVHEILSKLSLEGD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Neuroblast differentiation-associated protein AHNAK
Molecular weight formula_weight	2316.8 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

GKVTFPKMKIPKFTFSGREL

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	4drwA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4drwB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4drwC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4drwD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

▶

Unit-cell length a length_a	47.755 Å
Unit-cell length b length_b	47.791 Å
Unit-cell length c length_c	62.817 Å
Unit-cell angle α angle_alpha	71.62 °
Unit-cell angle β angle_beta	71.63 °
Unit-cell angle γ angle_gamma	68.62 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	43.340 Å
R factor r_factor	0.3220
R_work r_work	0.2960
R_free r_free	0.3270

Crystal Structure of the Ternary Complex between S100A10, an Annexin A2 N-terminal Peptide and an AHNAK Peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein S100-A10/Annexin A2 chimeric protein

State in the Current Structure

Other States of the Same Protein in the Database

Protein S100-A10/Annexin A2 chimeric protein

State in the Current Structure

Other States of the Same Protein in the Database

Neuroblast differentiation-associated protein AHNAK

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4drw__assembly_1__model_1

4drw__assembly_1__model_1 | I(q)

4drw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of the Ternary Complex between S100A10, an Annexin A2 N-terminal Peptide and an AHNAK Peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein S100-A10/Annexin A2 chimeric protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein S100-A10/Annexin A2 chimeric protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Neuroblast differentiation-associated protein AHNAK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4drw__assembly_1__model_1

4drw__assembly_1__model_1 | I(q)

4drw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)