SAXSdb — 4ftg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein S100-A10

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Annexin A2 × 2 （P07355） Neuroblast differentiation-associated protein AHNAK × 1 （Q09666） ISOPROPYL ALCOHOL × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S10AA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–96； UniProt 2–97 Author chain B； PDBConstruct 1–96； UniProt 2–97

Annexin A2

OrganismNot specified

UniProt P07355

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Protein S100-A10 × 2 （P60903） Neuroblast differentiation-associated protein AHNAK × 1 （Q09666） ISOPROPYL ALCOHOL × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANXA2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 2–16； UniProt 2–16 Author chain D； PDBConstruct 2–16； UniProt 2–16

Neuroblast differentiation-associated protein AHNAK

OrganismNot specified

UniProt Q09666

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Protein S100-A10 × 2 （P60903） Annexin A2 × 2 （P07355） ISOPROPYL ALCOHOL × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AHNK_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 2–21； UniProt 5654–5673

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ftg
Deposition date deposition_date	2012-06-27
Structure title title	The crystal structure of an AHNAK peptide in complex with the S100A10/AnxA2 heterotetramer
Keywords keywords	;Membrane repair, scaffold, AHNAK, Annexin A2, S100A10, calcium binding, inner-membrane surface, CALCIUM BINDING PROTEIN-PROTEIN BINDING complex, CALCIUM-BINDING PROTEIN-PROTEIN BINDING complex ;; CALCIUM-BINDING PROTEIN/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4ftg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4ftg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4ftg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.51 Å
Rg (electron density)	17.29 Å
Total Rg	18.33 Å
Atom count	1807
Residues	223
Excluded volume	32786 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4ftg__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Protein S100-A10
Molecular weight formula_weight	11088.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1815

PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Annexin A2
Molecular weight formula_weight	1653.9 kDa
Mutation mutation	C9S
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

XSTVHEILSKLSLEGDX

Entity 3 Entity 3 polymer

Description description	Neuroblast differentiation-associated protein AHNAK
Molecular weight formula_weight	2340.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

XGKVTFPKMKIPKFTFSGRELX

Entity 4 Entity 4 non-polymer

Description description	ISOPROPYL ALCOHOL
Molecular weight formula_weight	60.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	8

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	4ftgA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4ftgB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

▶

Unit-cell length a length_a	79.072 Å
Unit-cell length b length_b	55.216 Å
Unit-cell length c length_c	63.140 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	111.73 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.505 Å
Low-resolution limit resolution_low	29.327 Å
R factor r_factor	0.1846
R_work r_work	0.1813
R_free r_free	0.2507

The crystal structure of an AHNAK peptide in complex with the S100A10/AnxA2 heterotetramer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein S100-A10

State in the Current Structure

Other States of the Same Protein in the Database

Annexin A2

State in the Current Structure

Other States of the Same Protein in the Database

Neuroblast differentiation-associated protein AHNAK

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4ftg__assembly_1__model_1

4ftg__assembly_1__model_1 | I(q)

4ftg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

The crystal structure of an AHNAK peptide in complex with the S100A10/AnxA2 heterotetramer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein S100-A10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Annexin A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Neuroblast differentiation-associated protein AHNAK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4ftg__assembly_1__model_1

4ftg__assembly_1__model_1 | I(q)

4ftg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)