4ibi

Ebola virus VP35 bound to small molecule

Method: X-RAY DIFFRACTION D_max: 73.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polymerase cofactor VP35

Ebola virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 215–340	Fragment：unp residues 215-340	1D8 3-{(2S)-2-(7-chloro-1,3-benzodioxol-5-yl)-4-hydroxy-5-oxo-3-[3-(trifluoromethyl)benzoyl]-2,5-dihydro-1H-pyrrol-1-yl}benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMS, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.47 Å R-free 0.237
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 215–340	Fragment：unp residues 215-340	1D8 3-{(2S)-2-(7-chloro-1,3-benzodioxol-5-yl)-4-hydroxy-5-oxo-3-[3-(trifluoromethyl)benzoyl]-2,5-dihydro-1H-pyrrol-1-yl}benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMS, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.47 Å R-free 0.237

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4IBI	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3FKE Structure of the Ebola VP35 Interferon Inhibitory Domain Deposited 2008-12-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：UNP residues 215-340, interferon inhibitory domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.8；298 K；Well solution: 200 mM Sodium Citrate (pH 5.8),11% (W/V) PEG 4000; protein solution: 20 mM Tris-Cl (pH 7.0),50 mM NaCl, 5mM beta-mercaptoethanol, Vapor Diffusion, Hanging Drop, Temperature 298K, VAPOR DIFFUSION, HANGING DROP	Resolution 1.40 Å R-free 0.236
3FKE Structure of the Ebola VP35 Interferon Inhibitory Domain Deposited 2008-12-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：UNP residues 215-340, interferon inhibitory domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.8；298 K；Well solution: 200 mM Sodium Citrate (pH 5.8),11% (W/V) PEG 4000; protein solution: 20 mM Tris-Cl (pH 7.0),50 mM NaCl, 5mM beta-mercaptoethanol, Vapor Diffusion, Hanging Drop, Temperature 298K, VAPOR DIFFUSION, HANGING DROP	Resolution 1.40 Å R-free 0.236
3L25 Crystal structure of Zaire Ebola VP35 interferon inhibitory domain bound to 8 bp dsRNA Deposited 2009-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 215–340（126 aa） Fragment：Zaire Ebola VP35 interferon inhibitory domain Chain B 215–340（126 aa） Fragment：Zaire Ebola VP35 interferon inhibitory domain Chain D 215–340（126 aa） Fragment：Zaire Ebola VP35 interferon inhibitory domain Chain E 215–340（126 aa） Fragment：Zaire Ebola VP35 interferon inhibitory domain	Not recorded	MG MAGNESIUM ION × 1 CL CHLORIDE ION × 4 NA SODIUM ION × 8 GOL GLYCEROL × 1 FMT FORMIC ACID × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.2；293 K；3M SODIUM FORMATE, 0.1M SODIUM CITRATE, 5% GLYCEROL, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.207
3L26 Crystal structure of Zaire Ebola VP35 interferon inhibitory domain bound to 8 bp dsRNA Deposited 2009-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 215–340（126 aa） Fragment：Zaire Ebola VP35 interferon inhibitory domain Chain B 215–340（126 aa） Fragment：Zaire Ebola VP35 interferon inhibitory domain	Not recorded	MG MAGNESIUM ION × 10 CL CHLORIDE ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.7；293 K；2.9M SODIUM FORMATE, 0.1M SODIUM CITRATE, pH 4.7, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.254
3L27 Crystal structure of Zaire Ebola VP35 interferon inhibitory domain R312A mutant Deposited 2009-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 215–340（126 aa） Fragment：INTERFERON INHIBITORY DOMAIN Chain B 215–340（126 aa） Fragment：INTERFERON INHIBITORY DOMAIN Chain C 215–340（126 aa） Fragment：INTERFERON INHIBITORY DOMAIN Chain D 215–340（126 aa） Fragment：INTERFERON INHIBITORY DOMAIN	Mutation：R312A Mutation：R312A Mutation：R312A Mutation：R312A	CL CHLORIDE ION × 6 PO4 PHOSPHATE ION × 9 GOL GLYCEROL × 10 NA SODIUM ION × 1 K POTASSIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.15；293 K；1.85 M SODIUM PHOSPHATE, 0.15 M POTASSIUM PHOSPHATE, pH 4.15, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.95 Å R-free 0.229
3L28 Crystal structure of Zaire Ebola VP35 interferon inhibitory domain K339A mutant Deposited 2009-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 215–340（126 aa） Fragment：VP35 INTERFERON INHIBITORY DOMAIN Chain B 215–340（126 aa） Fragment：VP35 INTERFERON INHIBITORY DOMAIN Chain C 215–340（126 aa） Fragment：VP35 INTERFERON INHIBITORY DOMAIN Chain D 215–340（126 aa） Fragment：VP35 INTERFERON INHIBITORY DOMAIN Chain E 215–340（126 aa） Fragment：VP35 INTERFERON INHIBITORY DOMAIN Chain F 215–340（126 aa） Fragment：VP35 INTERFERON INHIBITORY DOMAIN	Mutation：K339A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：K339A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：K339A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：K339A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：K339A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：K339A Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 10 CL CHLORIDE ION × 12 NA SODIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 2.8；293 K；0.1M SODIUM CITRATE, 0.3M LITHIUM SULFATE, 13% PEG8000, pH 2.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.269
3L29 Crystal Structure of Zaire Ebola VP35 interferon inhibitory domain K319A/R322A mutant Deposited 2009-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：Zaire Ebola VP35 interferon inhibitory domain	Mutation：K319A, R322A	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.75；293 K；0.1M BIS-TRIS, 0.2M AMMONIUM SULFATE, 28% PEG3350, pH 6.75, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.70 Å R-free 0.232
3L29 Crystal Structure of Zaire Ebola VP35 interferon inhibitory domain K319A/R322A mutant Deposited 2009-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：Zaire Ebola VP35 interferon inhibitory domain	Mutation：K319A, R322A	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.75；293 K；0.1M BIS-TRIS, 0.2M AMMONIUM SULFATE, 28% PEG3350, pH 6.75, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.70 Å R-free 0.232
4IBB Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1DK {4-[(5R)-3-hydroxy-2-oxo-4-(thiophen-2-ylcarbonyl)-5-(2,4,5-trimethylphenyl)-2,5-dihydro-1H-pyrrol-1-yl]phenyl}acetic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100 mM magnesium acetate, pH7.5, 15% PEG3350, 10% DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.75 Å R-free 0.226
4IBB Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1DK {4-[(5R)-3-hydroxy-2-oxo-4-(thiophen-2-ylcarbonyl)-5-(2,4,5-trimethylphenyl)-2,5-dihydro-1H-pyrrol-1-yl]phenyl}acetic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100 mM magnesium acetate, pH7.5, 15% PEG3350, 10% DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.75 Å R-free 0.226
4IBC Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	12G {4-[(2R)-3-(2-chlorobenzoyl)-2-(2-chlorophenyl)-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl]phenyl}acetic acid × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100 mM magnesium acetate, pH7.5, 15% PEG3350, 10% DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.75 Å R-free 0.250
4IBC Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	12G {4-[(2R)-3-(2-chlorobenzoyl)-2-(2-chlorophenyl)-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl]phenyl}acetic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100 mM magnesium acetate, pH7.5, 15% PEG3350, 10% DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.75 Å R-free 0.250
4IBD Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1DL 5-[(2R)-3-benzoyl-2-(4-bromothiophen-2-yl)-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl]-2-methylbenzoic acid × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.84 Å R-free 0.233
4IBD Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1DL 5-[(2R)-3-benzoyl-2-(4-bromothiophen-2-yl)-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl]-2-methylbenzoic acid × 1 GOL GLYCEROL × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.84 Å R-free 0.233
4IBE Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	11Y 5-[(2R)-3-benzoyl-2-(4-bromothiophen-2-yl)-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl]-2-chlorobenzoic acid × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.95 Å R-free 0.233
4IBE Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	11Y 5-[(2R)-3-benzoyl-2-(4-bromothiophen-2-yl)-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl]-2-chlorobenzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.95 Å R-free 0.233
4IBF Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1D5 (4-{(2R)-2-(4-bromothiophen-2-yl)-3-[(5-chlorothiophen-2-yl)carbonyl]-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl}phenyl)acetic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.29 Å R-free 0.260
4IBF Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1D5 (4-{(2R)-2-(4-bromothiophen-2-yl)-3-[(5-chlorothiophen-2-yl)carbonyl]-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl}phenyl)acetic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.29 Å R-free 0.260
4IBG Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 215–340（126 aa） Fragment：unp residues 215-340 Chain B 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1D6 {4-[(2S)-2-(7-chloro-1,3-benzodioxol-5-yl)-4-hydroxy-3-(3-methylbenzoyl)-5-oxo-2,5-dihydro-1H-pyrrol-1-yl]phenyl}acetic acid × 2 SO4 SULFATE ION × 4 GOL GLYCEROL × 3 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.41 Å R-free 0.200
4IBJ Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1D9 3-{(5S)-3-hydroxy-2-oxo-4-[3-(trifluoromethyl)benzoyl]-5-[3-(trifluoromethyl)phenyl]-2,5-dihydro-1H-pyrrol-1-yl}benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.54 Å R-free 0.229
4IBJ Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1D9 3-{(5S)-3-hydroxy-2-oxo-4-[3-(trifluoromethyl)benzoyl]-5-[3-(trifluoromethyl)phenyl]-2,5-dihydro-1H-pyrrol-1-yl}benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.54 Å R-free 0.229
4IBK Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1DE 3-{(2S)-2-(7-chloro-1,3-benzodioxol-5-yl)-3-[(5-chlorothiophen-2-yl)carbonyl]-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl}benzoic acid × 1 GOL GLYCEROL × 1 DMS DIMETHYL SULFOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.85 Å R-free 0.241
4IBK Ebola virus VP35 bound to small molecule Deposited 2012-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 215–340（126 aa） Fragment：unp residues 215-340	Not recorded	1DE 3-{(2S)-2-(7-chloro-1,3-benzodioxol-5-yl)-3-[(5-chlorothiophen-2-yl)carbonyl]-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl}benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM sodium citrate, pH5.5, 15% PEG3350, 10%DMSO, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.85 Å R-free 0.241
4IJE Crystal structure of the Zaire ebolavirus VP35 interferon inhibitory domain R312A/K319A/R322A mutant Deposited 2012-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 218–340（123 aa） Fragment：interferon inhibitory domain (UNP residues 218-340)	Mutation：R312A, K319A, R322A	NA SODIUM ION × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298.15 K；2.2 M sodium potassium phosphate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.15K	Resolution 1.90 Å R-free 0.228
4IJE Crystal structure of the Zaire ebolavirus VP35 interferon inhibitory domain R312A/K319A/R322A mutant Deposited 2012-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 218–340（123 aa） Fragment：interferon inhibitory domain (UNP residues 218-340)	Mutation：R312A, K319A, R322A	NA SODIUM ION × 2 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298.15 K；2.2 M sodium potassium phosphate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.15K	Resolution 1.90 Å R-free 0.228
4IJE Crystal structure of the Zaire ebolavirus VP35 interferon inhibitory domain R312A/K319A/R322A mutant Deposited 2012-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 218–340（123 aa） Fragment：interferon inhibitory domain (UNP residues 218-340)	Mutation：R312A, K319A, R322A	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298.15 K；2.2 M sodium potassium phosphate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.15K	Resolution 1.90 Å R-free 0.228
4IJE Crystal structure of the Zaire ebolavirus VP35 interferon inhibitory domain R312A/K319A/R322A mutant Deposited 2012-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 218–340（123 aa） Fragment：interferon inhibitory domain (UNP residues 218-340)	Mutation：R312A, K319A, R322A	NA SODIUM ION × 2 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298.15 K；2.2 M sodium potassium phosphate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.15K	Resolution 1.90 Å R-free 0.228
4IJF Crystal structure of the Zaire ebolavirus VP35 interferon inhibitory domain K222A/R225A/K248A/K251A mutant Deposited 2012-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 218–340（123 aa） Fragment：interferon inhibitory domain (UNP residues 218-340)	Mutation：K222A, R225A, K248A, K251A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298.15 K；0.2 M magnesium chloride, 0.1 M HEPES, pH 7.5, 30% PEG400, VAPOR DIFFUSION, HANGING DROP, temperature 298.15K	Resolution 2.51 Å R-free 0.254
4YPI Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived from Ebola VP35 Deposited 2015-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 20–47（28 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；streak seeding in well solution containing 100 mM Tris pH 7.2, 50 mM Hepes pH 7, and 23% PEG400	Resolution 3.71 Å R-free 0.285
4YPI Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived from Ebola VP35 Deposited 2015-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 20–47（28 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；streak seeding in well solution containing 100 mM Tris pH 7.2, 50 mM Hepes pH 7, and 23% PEG400	Resolution 3.71 Å R-free 0.285
4YPI Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived from Ebola VP35 Deposited 2015-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 20–47（28 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；streak seeding in well solution containing 100 mM Tris pH 7.2, 50 mM Hepes pH 7, and 23% PEG400	Resolution 3.71 Å R-free 0.285
4YPI Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived from Ebola VP35 Deposited 2015-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 20–47（28 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；streak seeding in well solution containing 100 mM Tris pH 7.2, 50 mM Hepes pH 7, and 23% PEG400	Resolution 3.71 Å R-free 0.285
4ZTA Ebola virus nucleoprotein bound to VP35 chaperoning peptide I212121 Deposited 2015-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 15–59（45 aa） Fragment：UNP Q05127 residues 15-59,UNP P18272 residues 33-367,UNP Q05127 residues 15-59,UNP P18272 residues 33-367	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；277 K；2.2M Sodium formate, 100mM NaOAc pH 4.7	Resolution 2.40 Å R-free 0.233
4ZTG Ebola virus nucleoprotein bound to VP35 chaperoning peptide P22121 Deposited 2015-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 15–59（45 aa） Fragment：UNP Q05127 residues 15-59, UNP P18272 residues 33-367	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；12% PEG 6000, 100 mM MES pH 5.0	Resolution 2.80 Å R-free 0.293
4ZTI Ebola virus nucleoprotein bound to VP35 chaperoning peptide P212121 Deposited 2015-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 15–59（45 aa） Fragment：UNP Q05127 residues 15-59,UNP P18272 residues 33-367	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.4；277 K；2.0 M sodium formate, 100 mM sodium acetate pH 4.4	Resolution 2.40 Å R-free 0.247
4ZTI Ebola virus nucleoprotein bound to VP35 chaperoning peptide P212121 Deposited 2015-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 15–59（45 aa） Fragment：UNP Q05127 residues 15-59,UNP P18272 residues 33-367	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.4；277 K；2.0 M sodium formate, 100 mM sodium acetate pH 4.4	Resolution 2.40 Å R-free 0.247
6GBO Crystal Structure of the oligomerization domain of Vp35 from Ebola virus Deposited 2018-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 82–145（64 aa） Fragment：oligomerization domain Chain B 82–145（64 aa） Fragment：oligomerization domain Chain C 82–145（64 aa） Fragment：oligomerization domain Chain D 82–145（64 aa） Fragment：oligomerization domain Chain E 82–145（64 aa） Fragment：oligomerization domain Chain F 82–145（64 aa） Fragment：oligomerization domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；296 K；50 mM HEPES-NaOH pH 7.5, 2.5 M Na-acetate	Resolution 2.10 Å R-free 0.242
6GBO Crystal Structure of the oligomerization domain of Vp35 from Ebola virus Deposited 2018-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 82–145（64 aa） Fragment：oligomerization domain Chain H 82–145（64 aa） Fragment：oligomerization domain Chain I 82–145（64 aa） Fragment：oligomerization domain Chain J 82–145（64 aa） Fragment：oligomerization domain Chain K 82–145（64 aa） Fragment：oligomerization domain Chain L 82–145（64 aa） Fragment：oligomerization domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；296 K；50 mM HEPES-NaOH pH 7.5, 2.5 M Na-acetate	Resolution 2.10 Å R-free 0.242
6GBP Crystal Structure of the oligomerization domain of VP35 from Ebola virus, mercury derivative Deposited 2018-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 82–145（64 aa） Fragment：oligomerization domain Chain B 82–145（64 aa） Fragment：oligomerization domain Chain C 82–145（64 aa） Fragment：oligomerization domain	Not recorded	HG MERCURY (II) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；296 K；50 mM HEPES-NaOH pH 7.5, 2.6 M Na-acetate	Resolution 3.49 Å R-free 0.281
6GBP Crystal Structure of the oligomerization domain of VP35 from Ebola virus, mercury derivative Deposited 2018-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain D 82–145（64 aa） Fragment：oligomerization domain Chain E 82–145（64 aa） Fragment：oligomerization domain Chain F 82–145（64 aa） Fragment：oligomerization domain	Not recorded	HG MERCURY (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；296 K；50 mM HEPES-NaOH pH 7.5, 2.6 M Na-acetate	Resolution 3.49 Å R-free 0.281
6GBP Crystal Structure of the oligomerization domain of VP35 from Ebola virus, mercury derivative Deposited 2018-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain G 82–145（64 aa） Fragment：oligomerization domain Chain H 82–145（64 aa） Fragment：oligomerization domain Chain I 82–145（64 aa） Fragment：oligomerization domain	Not recorded	HG MERCURY (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；296 K；50 mM HEPES-NaOH pH 7.5, 2.6 M Na-acetate	Resolution 3.49 Å R-free 0.281
6GBP Crystal Structure of the oligomerization domain of VP35 from Ebola virus, mercury derivative Deposited 2018-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain J 82–145（64 aa） Fragment：oligomerization domain Chain K 82–145（64 aa） Fragment：oligomerization domain Chain L 82–145（64 aa） Fragment：oligomerization domain	Not recorded	HG MERCURY (II) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；296 K；50 mM HEPES-NaOH pH 7.5, 2.6 M Na-acetate	Resolution 3.49 Å R-free 0.281
8USN Intracellular cryo-tomography structure of EBOV nucleocapsid at 8.9 Angstrom Deposited 2023-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 7 PDB declaration: nonameric	Chain F 1–340（340 aa） Chain K 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 8.90 Å
8UST In-virion structure of Ebola virus nucleocapsid-like assemblies from recombinant virus-like particles (nucleoprotein, VP24,VP35,VP40) Deposited 2023-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 7 PDB declaration: nonameric	Chain F 1–340（340 aa） Chain K 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.30 Å
9IP3 Cryo-EM structure of the RNA-dependent RNA polymerase complex in a compact conformation from Ebola virus Deposited 2024-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 80–340（261 aa） Chain C 80–340（261 aa） Chain D 80–340（261 aa） Chain E 80–340（261 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；25 mM HEPES, 300 mM NaCl, 1 mM TCEP, 6 mM MgCl2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

25 other PDB entries and 45 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VP35_EBOZM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–129； UniProt 215–340 Author chain B； PDBConstruct 4–129； UniProt 215–340

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ibi
Deposition date deposition_date	2012-12-08
Structure title title	Ebola virus VP35 bound to small molecule
Keywords keywords	interferon inhibitor domain, TRANSCRIPTION-TRANSCRIPTION inhibitor complex; TRANSCRIPTION/TRANSCRIPTION inhibitor
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	21.71 Å
Radius of gyration Rg (electron density) rg_electron	20.66 Å
Forward intensity I(0) i0	14404100.00
Molecular weight molecular_weight	28676.0 kDa
Excluded volume excluded_volume	36055 Å³
Envelope volume envelope_volume	43436 Å³
Hydration-shell volume shell_volume	18439 Å³
Envelope diameter envelope_diameter	78.2 Å
Shell Rg shell_rg	26.15 Å
Envelope Rg envelope_rg	20.89 Å
Shape Rg shape_rg	20.65 Å
Total Rg total_rg	21.53 Å
Total atoms total_atoms	2014
Residues n_residues	250
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	73.8 Å
Rg (real space) rg_real	21.80 Å
Rg uncertainty (real space) rg_real_error	0.64 Å
I(0) (real space) i0_real	1.4400e+07
I(0) uncertainty (real space) i0_real_error	2.2360e+05
Rg (reciprocal space) rg_reciprocal	21.78 Å
I(0) (reciprocal space) i0_reciprocal	14400000.0000
Solution quality estimate total_estimate	0.7836
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	23.1 Å
Skewness Skewness skewness	0.480
Kurtosis Kurtosis kurtosis	-0.174
Angular range angular_range	— – 0.3650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2980000.0000
Real-space data points n_real_points	68
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.760; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.903; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Polymerase cofactor VP35
Molecular weight formula_weight	14210.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2362

GHMGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI

来源 Source

来源生物 organism	Ebola virus
通用名 common_name	ZEBOV
NCBI Class编号 ncbi_taxonomy_id	128952
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	3-{(2S)-2-(7-chloro-1,3-benzodioxol-5-yl)-4-hydroxy-5-oxo-3-[3-(trifluoromethyl)benzoyl]-2,5-dihydro-1H-pyrrol-1-yl}benzoic acid
Molecular weight formula_weight	545.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	259

▼

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d4ibia_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.388 — Filoviridae VP35-like
Superfamily Superfamily superfamily	d.388.1 — Filoviridae VP35-like
Family Family family	d.388.1.1 — Filoviridae VP35

Domain ID domain_id	d4ibib1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.388 — Filoviridae VP35-like
Superfamily Superfamily superfamily	d.388.1 — Filoviridae VP35-like
Family Family family	d.388.1.1 — Filoviridae VP35

Domain ID domain_id	d4ibib2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	4ibiA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	950 — Filoviridae VP35, C-terminal inhibitory domain, helical subdomain

Domain ID domain_id	4ibiA02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	10 — Seminal Fluid Protein PDC-109 (Domain B)
Homologous superfamily homologous superfamily	70 — Filoviridae VP35, C-terminal inhibitory domain, beta-sheet subdomain

Domain ID domain_id	4ibiB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	950 — Filoviridae VP35, C-terminal inhibitory domain, helical subdomain

Domain ID domain_id	4ibiB02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	10 — Seminal Fluid Protein PDC-109 (Domain B)
Homologous superfamily homologous superfamily	70 — Filoviridae VP35, C-terminal inhibitory domain, beta-sheet subdomain

▶

8. Citations (1)

▶

Unit-cell length a length_a	51.302 Å
Unit-cell length b length_b	65.451 Å
Unit-cell length c length_c	72.653 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.473 Å
Low-resolution limit resolution_low	41.907 Å
R factor r_factor	0.1922
R_work r_work	0.1898
R_free r_free	0.2372

fit	/app/data/saxs_computation/ib/4ibi/4ibi.fit
pddf	/app/data/pr_computation/ib/4ibi/4ibi.pr.out
profile	/app/data/saxs_computation/ib/4ibi/4ibi.dat