4kuc

Crystal structure of ricin-A chain in complex with the antibody 6C2

Method: X-RAY DIFFRACTION D_max: 120.6 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ricin

Ricinus communis

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 36–302	Not recorded	mAb6c2 fab-Heavy chain × 1 mAb6c2 fab-Light chain × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5；289 K；0.1M Nacitrate,ph 5.0, 8% PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.79 Å R-free 0.289
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain I； UniProt 36–302	Not recorded	mAb6c2 fab-Heavy chain × 1 mAb6c2 fab-Light chain × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5；289 K；0.1M Nacitrate,ph 5.0, 8% PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.79 Å R-free 0.289

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4KUC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BR5 RICIN A CHAIN (RECOMBINANT) COMPLEX WITH NEOPTERIN Deposited 1998-08-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	NEO NEOPTERIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.9；pH 8.9	Resolution 2.50 Å
1BR6 RICIN A CHAIN (RECOMBINANT) COMPLEX WITH PTEROIC ACID Deposited 1998-08-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 35–302（268 aa）	Not recorded	PT1 PTEROIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.9；pH 8.9	Resolution 2.30 Å
1IFS RICIN A-CHAIN (RECOMBINANT) COMPLEX WITH ADENOSINE (ADENOSINE BECOMES ADENINE IN THE COMPLEX) Deposited 1996-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 38–298（261 aa） Fragment：A CHAIN	Mutation：I1M, F2V	ADE ADENINE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1IFT RICIN A-CHAIN (RECOMBINANT) Deposited 1996-07-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 38–298（261 aa） Fragment：A CHAIN	Mutation：I1M, F2V	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
1IFU RICIN A-CHAIN (RECOMBINANT) COMPLEX WITH FORMYCIN Deposited 1996-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 38–298（261 aa） Fragment：A CHAIN	Mutation：I1M, F2V	FMC (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1IL3 STRUCTURE OF RICIN A CHAIN BOUND WITH INHIBITOR 7-DEAZAGUANINE Deposited 2001-05-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	7DG 7-DEAZAGUANINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.9；277 K；PEG 8000, TRIS-HCL, BETA-MERCAPTOETHANOL, EDTA, pH 8.9, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.273
1IL4 STRUCTURE OF RICIN A CHAIN BOUND WITH INHIBITOR 9-DEAZAGUANINE Deposited 2001-05-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	9DG 9-DEAZAGUANINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.9；277 K；PEG 8000, TRIS-HCL, BETA-MERCAPTOETHANOL, EDTA, 9-DEAZAGUANINE, pH 8.9, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.60 Å R-free 0.293
1IL5 STRUCTURE OF RICIN A CHAIN BOUND WITH INHIBITOR 2,5-DIAMINO-4,6-DIHYDROXYPYRIMIDINE (DDP) Deposited 2001-05-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	DDP 2,4-DIAMINO-4,6-DIHYDROXYPYRIMIDINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.9；277 K；PEG 8000, TRIS-HCL, BETA-MERCAPTOETHANOL, EDTA, 2,5-DIAMINO-4,6-DIHYDROXYPYRIMIDINE, pH 8.9, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.283
1IL5 STRUCTURE OF RICIN A CHAIN BOUND WITH INHIBITOR 2,5-DIAMINO-4,6-DIHYDROXYPYRIMIDINE (DDP) Deposited 2001-05-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 36–302（267 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.9；277 K；PEG 8000, TRIS-HCL, BETA-MERCAPTOETHANOL, EDTA, 2,5-DIAMINO-4,6-DIHYDROXYPYRIMIDINE, pH 8.9, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.283
1IL9 STRUCTURE OF RICIN A CHAIN BOUND WITH INHIBITOR 8-METHYL-9-OXOGUANINE Deposited 2001-05-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	MOG 5-AMINO-2-METHYL-6H-OXAZOLO[5,4-D]PYRIMIDIN-7-ONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.9；277 K；PEG 8000, TRIS-HCL, BETA-MERCAPTOETHANOL, EDTA, 8-METHYL-9-OXOGUANINE, pH 8.9, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.10 Å R-free 0.306
1J1M Ricin A-Chain (Recombinant) at 100K Deposited 2002-12-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Mutation：N137D	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；0.9M Ammomium Sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.50 Å R-free 0.213
1OBS STRUCTURE OF RICIN A CHAIN MUTANT Deposited 1996-06-25	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Mutation：R180H	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1OBT STRUCTURE OF RICIN A CHAIN MUTANT, COMPLEX WITH AMP Deposited 1996-06-22	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Mutation：R180H	AMP ADENOSINE MONOPHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1RTC THE STRUCTURE OF RECOMBINANT RICIN A CHAIN AT 2.3 ANGSTROMS Deposited 1992-10-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1UQ4 RICIN A-CHAIN (RECOMBINANT) R213D MUTANT Deposited 2003-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 40–302（263 aa） Fragment：A CHAIN, RESIDUES 40-302	Mutation：YES	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；SEE REFERENCE 1, pH 4.20	Resolution 1.90 Å R-free 0.231
1UQ5 RICIN A-CHAIN (RECOMBINANT) N122A MUTANT Deposited 2003-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 40–302（263 aa） Fragment：A CHAIN, RESIDUES 40-302	Mutation：YES	ACT ACETATE ION × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；SEE REFERENCE 1, pH 4.20	Resolution 1.40 Å R-free 0.214
2AAI Crystallographic refinement of ricin to 2.5 Angstroms Deposited 1993-09-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa） Chain B 315–576（262 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2P8N Ricin a-chain (recombinant) complex with adenine Deposited 2007-03-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa） Fragment：residues 36-302	Not recorded	SO4 SULFATE ION × 3 ADE ADENINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；295 K；20% AMMONIUM SULFATE, 50 MIMILLIMOLAR SODIUM ACETATE, PH 4.2, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 295K, pH 4.20	Resolution 1.94 Å R-free 0.301
2PJO Ricin a-chain (recombinant) complex with n-methylurea Deposited 2007-04-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	SO4 SULFATE ION × 2 NMU N-METHYLUREA × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；295 K；AMMONIUM SULFATE, SODIUM ACETATE, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 295K, pH 4.20	Resolution 1.80 Å R-free 0.247
2R2X Ricin A-chain (recombinant) complex with Urea Deposited 2007-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	SO4 SULFATE ION × 2 URE UREA × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；295 K；Ammonium sulfate, sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.40 Å R-free 0.297
2R3D Ricin A-chain (recombinant) complex with Acetamide Deposited 2007-08-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa） Fragment：Unp residues 36-302	Not recorded	SO4 SULFATE ION × 2 ACM ACETAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；295 K；Ammonium sulfate, sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.09 Å R-free 0.272
2VC3 Ricin A-Chain (Recombinant) E177D Mutant with a bound acetate Deposited 2007-09-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa） Fragment：RESIDUES 36-302	Mutation：YES	ACT ACETATE ION × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；pH 4.2	Resolution 1.60 Å R-free 0.209
2VC4 Ricin A-Chain (Recombinant) E177D Mutant Deposited 2007-09-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa） Fragment：RESIDUES 36-302	Mutation：YES	GOL GLYCEROL × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；pH 4.2	Resolution 1.39 Å R-free 0.199
3EJ5 complex of Ricin A chain and pyrimidine-based inhibitor Deposited 2008-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 40–296（257 aa） Fragment：sequence database residues 40-296	Not recorded	EJ5 4-[3-(2-amino-4-hydroxy-6-oxo-1,6-dihydropyrimidin-5-yl)propyl]benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.9；277 K；tris-HCl, BME, EDTA, PEG 8000, pH 8.9, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.266
3HIO Crystal structure of Ricin A-chain in complex with the cyclic tetranucleotide inhibitor, a transition state analogue Deposited 2009-05-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	C2X 9,9'-{(2R,3R,3aR,5S,7aR,9R,10R,10aR,12S,23R,25aR,27R,28R,28aR,30S,32aR,35aR,37S,39aR)-9-(6-amino-9H-purin-9-yl)-34-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-5,12,23,30,37-pentahydroxy-3,10,28-trimethoxy-5,12,23,30,37-pentaoxidotetracosahydro-2H,7H,25H-trifuro[3,2-f:3',2'-l:3'',2''-x]pyrrolo[3,4-r][1,3,5,9,11,15,17,21,23,27,29,2,4,10,16,22,28]undecaoxazapentaphosphacyclopentatriacontine-2,27-diyl}bis(2-amino-3,9-dihydro-6H-purin-6-one) × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；291 K；25% PEG2000, 0.2M Lithium sulfate, 0.1M Sodium acetate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.254
3LC9 Ricin A-chain variant 1-33/44-198 with engineered disulfide bond Deposited 2010-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–233（198 aa）	Mutation：R48C, T77C	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；290 K；Protein buffer: 50mM MES pH 6.4, 200mM NaCl Crystallization Solution: 0.17M Ammonium Sulfate, 25.5% w/v PEG 4000, 15% v/v Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.28 Å R-free 0.245
3MK9 Stabilized Ricin Immunogen 1-33/44-198 Deposited 2010-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–233（198 aa）	Mutation：V49C, E99C	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；290 K；Protein Buffer: 50mM MES pH 6.4, 200mM NaCl, 2mM BME, Crystallization Solution: 0.17M Ammonium Sulfate, 25.5% w/v PEG 4000, 15% v/v Glycerol , VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.08 Å R-free 0.236
3RTI Crystal structure of ricin bound with formycin monophosphate Deposited 2011-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa） Fragment：Ricin A chain Chain B 315–576（262 aa） Fragment：Ricin B chain	Not recorded	FMP FORMYCIN-5'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions batch；pH 4.75；298 K；11.5% PEG 8000, 0.05 M sodium acetate, 2 mM lactose, pH 4.75, batch, temperature 298K	Resolution 2.80 Å
3RTJ Crystal structure of ricin bound with dinucleotide ApG Deposited 2011-05-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 36–302（267 aa） Chain B 315–576（262 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions batch；pH 4.75；298 K；11.5% PEG 8000, 0.05 M sodium acetate, 2 mM lactose, pH 4.75, batch, temperature 298K	Resolution 3.00 Å
3SRP Structure of Rivax: A Human Ricin Vaccine Deposited 2011-07-07	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Mutation：V76M, Y80A	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；290 K；30% Ammonium Sulfate, 50 mM Sodium Acetate pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.14 Å R-free 0.254
4ESI Structure of ricin A chain bound with N-((1H-1,2,3-triazol-4-yl)methyl-2-amino-4-oxo-3,4-dihydropteridine-7-carboxamide Deposited 2012-04-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	0RB 2-amino-4-oxo-N-(1H-1,2,3-triazol-5-ylmethyl)-1,4-dihydropteridine-7-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.87 Å R-free 0.285
4HUO Structure of Ricin A chain bound with N-(N-(pterin-7-yl)carbonylglycyl)-L-phenylalanine Deposited 2012-11-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 36–302（267 aa）	Not recorded	RS8 N-[(2-amino-4-oxo-1,4-dihydropteridin-7-yl)carbonyl]glycyl-L-phenylalanine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M Ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.52 Å R-free 0.230
4HUO Structure of Ricin A chain bound with N-(N-(pterin-7-yl)carbonylglycyl)-L-phenylalanine Deposited 2012-11-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain X 36–302（267 aa）	Not recorded	RS8 N-[(2-amino-4-oxo-1,4-dihydropteridin-7-yl)carbonyl]glycyl-L-phenylalanine × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M Ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.52 Å R-free 0.230
4HUP Structure of ricin A chain bound with N-(N-(pterin-7-yl)carbonylglycyl)-L-phenylalanyl)-L-phenylalanine Deposited 2012-11-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 36–302（267 aa）	Not recorded	19M (2S)-2-[[(2S)-2-[2-[(2-azanyl-4-oxidanylidene-1H-pteridin-7-yl)carbonylamino]ethanoylamino]-3-phenyl-propanoyl]amino]-3-phenyl-propanoic acid × 1 SO4 SULFATE ION × 2 MLA MALONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.70 Å R-free 0.236
4HUP Structure of ricin A chain bound with N-(N-(pterin-7-yl)carbonylglycyl)-L-phenylalanyl)-L-phenylalanine Deposited 2012-11-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain X 36–302（267 aa）	Not recorded	19M (2S)-2-[[(2S)-2-[2-[(2-azanyl-4-oxidanylidene-1H-pteridin-7-yl)carbonylamino]ethanoylamino]-3-phenyl-propanoyl]amino]-3-phenyl-propanoic acid × 2 SO4 SULFATE ION × 4 MLA MALONIC ACID × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.70 Å R-free 0.236
4HV3 Structure of Ricin A chain bound with N-(N-(pterin-7-yl)carbonyl-L-serinyl)-L-tryptophan Deposited 2012-11-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	19L (2S)-2-[[(2S)-2-[(2-azanyl-4-oxidanylidene-1H-pteridin-7-yl)carbonylamino]-3-oxidanyl-propanoyl]amino]-3-(1H-indol-3-yl)propanoic acid × 1 SO4 SULFATE ION × 1 MLA MALONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M Ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.54 Å R-free 0.231
4HV7 Structure of ricin A chain bound with N-(N-(pterin-7-yl)carbonylglycyl)glycine Deposited 2012-11-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 36–302（267 aa）	Not recorded	19J 2-[2-[(2-azanyl-4-oxidanylidene-1H-pteridin-7-yl)carbonylamino]ethanoylamino]ethanoic acid × 1 SO4 SULFATE ION × 1 MLA MALONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.87 Å R-free 0.236
4HV7 Structure of ricin A chain bound with N-(N-(pterin-7-yl)carbonylglycyl)glycine Deposited 2012-11-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain X 36–302（267 aa）	Not recorded	19J 2-[2-[(2-azanyl-4-oxidanylidene-1H-pteridin-7-yl)carbonylamino]ethanoylamino]ethanoic acid × 2 SO4 SULFATE ION × 2 MLA MALONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.87 Å R-free 0.236
4IMV Ricin A-chain variant 1-33/44-198 with engineered disulfide bond, R48C/T77C/D75N Deposited 2013-01-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–233（198 aa） Fragment：unp residues 36-233	Mutation：R48C, T77C, D75N	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；290 K；0.17 M Ammonium Sulfate, 25.5% (w/v) Peg 4000, 15% Glycerol , pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.25 Å R-free 0.242
4LGP Ricin A chain bound to camelid nanobody (VHH1) Deposited 2013-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–296（261 aa） Fragment：UNP residues 36-296	Not recorded	CL CHLORIDE ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293 K；100 mM Bicine, 20 % PEG 6000, pH 8.5, VAPOR DIFFUSION, temperature 293K	Resolution 2.40 Å R-free 0.281
4LGP Ricin A chain bound to camelid nanobody (VHH1) Deposited 2013-06-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 36–296（261 aa） Fragment：UNP residues 36-296	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293 K；100 mM Bicine, 20 % PEG 6000, pH 8.5, VAPOR DIFFUSION, temperature 293K	Resolution 2.40 Å R-free 0.281
4LGR Ricin A chain bound to camelid nanobody (VHH3) Deposited 2013-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 40–294（255 aa） Fragment：UNP residues 40-294	Not recorded	ZN ZINC ION × 3 ACY ACETIC ACID × 2 CL CHLORIDE ION × 8 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.5；293 K；100 mM NaAcetate, 200 mM Zinc Acetate, 10% PEG 3000, pH 4.5, VAPOR DIFFUSION, temperature 293K	Resolution 1.65 Å R-free 0.204
4LGS Ricin A chain bound to camelid nanobody (VHH4) Deposited 2013-06-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 39–301（263 aa） Fragment：UNP residues 39-301	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；293 K；100 mM NaHepes, 20% PEG 8000, pH 7.5, VAPOR DIFFUSION, temperature 293K	Resolution 2.70 Å R-free 0.248
4LHJ Ricin A chain bound to camelid nanobody (VHH5) Deposited 2013-07-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 39–297（259 aa） Fragment：UNP residues 39-297	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.5；293 K；100 mM NaAcetate, 200 mM NaCl, 40% PEG 300, pH 4.5, VAPOR DIFFUSION, temperature 293K	Resolution 1.80 Å R-free 0.250
4LHQ Ricin A chain bound to camelid nanobody (VHH8) Deposited 2013-07-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 39–298（260 aa） Fragment：UNP residues 39-298	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.6；293 K；100 mM NaAcetate, 2 M NaFormate, pH 4.6, VAPOR DIFFUSION, temperature 293K	Resolution 2.30 Å R-free 0.248
4LHQ Ricin A chain bound to camelid nanobody (VHH8) Deposited 2013-07-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 39–298（260 aa） Fragment：UNP residues 39-298	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.6；293 K；100 mM NaAcetate, 2 M NaFormate, pH 4.6, VAPOR DIFFUSION, temperature 293K	Resolution 2.30 Å R-free 0.248
4MX1 Structure of ricin A chain bound with 2-amino-4-oxo-N-(2-(3-phenylureido)ethyl)-3,4-dihydropteridine-7-carboxamide Deposited 2013-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	1MX 2-amino-4-oxo-N-{2-[(phenylcarbamoyl)amino]ethyl}-3,4-dihydropteridine-7-carboxamide × 1 SO4 SULFATE ION × 1 MLA MALONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.59 Å R-free 0.261
4MX5 Structure of ricin A chain bound with benzyl-(2-(2-amino-4-oxo-3,4-dihydropteridine-7-carboxamido)ethyl)carbamate Deposited 2013-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 36–302（267 aa）	Not recorded	5MX benzyl (2-{[(2-amino-4-oxo-3,4-dihydropteridin-7-yl)carbonyl]amino}ethyl)carbamate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；1.3 M ammonium sulfate, 0.1 M sodium malonate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.52 Å R-free 0.245
4Q2V Crystal Structure of Ricin A chain complexed with Baicalin inhibitor Deposited 2014-04-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa） Fragment：Ricin A chain	Not recorded	0XE 5,6-dihydroxy-4-oxo-2-phenyl-4H-chromen-7-yl beta-D-glucopyranosiduronic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.2M ammonium sulphate, 0.1M sodium acetate, 10% PEG 4000, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å R-free 0.243
4Z9K Ricin A chain bound to camelid nanobody (VHH2)(F5) Deposited 2015-04-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 39–296（258 aa） Fragment：UNP residues 39-296	Not recorded	EDO 1,2-ETHANEDIOL × 2 ZN ZINC ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；295 K；100 mM Tris, 15% PEG 3000, 2 mM Zinc acetate, 10 mM sulfobetaine	Resolution 1.50 Å R-free 0.195
5BOZ Ricin A chain bound to camelid nanobody (VHH9)(E1) Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 39–299（261 aa） Fragment：UNP residues 39-298	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.45 M Ammonium Sulfate, 25% glycerol	Resolution 3.10 Å R-free 0.277
5BOZ Ricin A chain bound to camelid nanobody (VHH9)(E1) Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 39–299（261 aa） Fragment：UNP residues 39-298	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.45 M Ammonium Sulfate, 25% glycerol	Resolution 3.10 Å R-free 0.277
5BOZ Ricin A chain bound to camelid nanobody (VHH9)(E1) Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 39–299（261 aa） Fragment：UNP residues 39-298	Not recorded	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.45 M Ammonium Sulfate, 25% glycerol	Resolution 3.10 Å R-free 0.277
5BOZ Ricin A chain bound to camelid nanobody (VHH9)(E1) Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 39–299（261 aa） Fragment：UNP residues 39-298	Not recorded	SO4 SULFATE ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.45 M Ammonium Sulfate, 25% glycerol	Resolution 3.10 Å R-free 0.277
5BOZ Ricin A chain bound to camelid nanobody (VHH9)(E1) Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 39–299（261 aa） Fragment：UNP residues 39-298	Not recorded	SO4 SULFATE ION × 3 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.45 M Ammonium Sulfate, 25% glycerol	Resolution 3.10 Å R-free 0.277
5BOZ Ricin A chain bound to camelid nanobody (VHH9)(E1) Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 39–299（261 aa） Fragment：UNP residues 39-298	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.45 M Ammonium Sulfate, 25% glycerol	Resolution 3.10 Å R-free 0.277
5DDZ Crystal structure of the RTA-c10-P2 complex Deposited 2015-08-25	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；0.4 M ammonium dihydrogen phosphate	Resolution 1.50 Å R-free 0.175
5E1H Ricin toxin in complex with neutralizing single chain monoclonal antibodies (VHHs) Deposited 2015-09-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 40–297（258 aa）	Not recorded	CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；293 K；100 mM BisTris pH 5.5, 25% PEG 3000, 260 mM NaCl, and 10 mM Tris (2carboxyethyl)phosphine hydrochloride	Resolution 2.03 Å R-free 0.257
5GU4 rRNA N-glycosylase RTA Deposited 2016-08-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa） Fragment：UNP residues 36-302	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；2.8 M sodium acetate, tetrahydrate pH7.0 30%-35% glucose	Resolution 1.55 Å R-free 0.255
5GU4 rRNA N-glycosylase RTA Deposited 2016-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 36–302（267 aa） Fragment：UNP residues 36-302	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；2.8 M sodium acetate, tetrahydrate pH7.0 30%-35% glucose	Resolution 1.55 Å R-free 0.255
5J56 RTA-V1C7 Deposited 2016-04-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa） Fragment：UNP residues 40-294	Not recorded	PG4 TETRAETHYLENE GLYCOL × 1 ACY ACETIC ACID × 2 EDO 1,2-ETHANEDIOL × 1 CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；293 K；100 mM sodium acetate pH 4.6 and 8% PEG4000	Resolution 1.80 Å R-free 0.210
5J57 V5E1-RTA complex Deposited 2016-04-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa） Fragment：UNP residues 39-302	Not recorded	CL CHLORIDE ION × 5 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；100 mM Tris pH 7.0 and 20% PEG 1000	Resolution 1.70 Å R-free 0.190
5SV3 RTA1-33/44-198 (RVEC) bound to Single Domain Antibody A3C8 Deposited 2016-08-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 36–233（198 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；290 K；0.1 M HEPES pH 7.0, 1.6 M Ammonium Sulfate	Resolution 2.73 Å R-free 0.267
5SV3 RTA1-33/44-198 (RVEC) bound to Single Domain Antibody A3C8 Deposited 2016-08-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 36–233（198 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；290 K；0.1 M HEPES pH 7.0, 1.6 M Ammonium Sulfate	Resolution 2.73 Å R-free 0.267
5U4L RTA-V1C7_G29R-high-salt Deposited 2016-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa） Fragment：residues 36-302	Not recorded	PO4 PHOSPHATE ION × 3 CL CHLORIDE ION × 5 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；1.6 M ammonium dihydrogen phosphate, 20% glycerol, and 100 mM Tris pH 8.5	Resolution 2.50 Å R-free 0.257
5U4M RTA-V1C7-G29R-no_salt Deposited 2016-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 40–294（255 aa） Fragment：residues 40-294	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.6；295 K；8% PEG 4000 and 100 mM sodium acetate pH 4.6	Resolution 2.50 Å R-free 0.246
6CWG Ricin catalytic subunit bound go A9 VHH antibody Deposited 2018-03-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.5；295 K；200 mM Lithiuim sulfate, 100 mM CAPS pH 10.5, 2 M Ammonium sulfate	Resolution 2.60 Å R-free 0.262
6CWG Ricin catalytic subunit bound go A9 VHH antibody Deposited 2018-03-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 36–302（267 aa）	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.5；295 K；200 mM Lithiuim sulfate, 100 mM CAPS pH 10.5, 2 M Ammonium sulfate	Resolution 2.60 Å R-free 0.262
6OBC Ricin A chain bound to camelid Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 40–298（259 aa） Fragment：Toxin catalytic subunit, residues 40-298	Not recorded	CL CHLORIDE ION × 3 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；295 K；100 mM Tris (pH 7.0), 200 mM calcium acetate, and 20% PEG 3,000	Resolution 1.76 Å R-free 0.227
6OBE Ricin A chain bound to VHH antibody V6H8 Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 38–302（265 aa） Fragment：Toxin catalytic subunit, residues 38-302	Not recorded	NI NICKEL (II) ION × 2 EDO 1,2-ETHANEDIOL × 3 IMD IMIDAZOLE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；100 mM citric acid and 15% PEG	Resolution 1.73 Å R-free 0.208
6OBG Ricin A chain bound to VHH antibody V8E6 Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 40–296（257 aa） Fragment：Toxin catalytic subunit, residues 40-296	Not recorded	ZN ZINC ION × 5 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；295 K；100 mM MES (pH 6.0), 170 mM zinc acetate, 6% PEG 8,000, and 0.5% ethyl acetate	Resolution 2.00 Å R-free 0.218
6OBG Ricin A chain bound to VHH antibody V8E6 Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 40–296（257 aa） Fragment：Toxin catalytic subunit, residues 40-296	Not recorded	ZN ZINC ION × 4 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；295 K；100 mM MES (pH 6.0), 170 mM zinc acetate, 6% PEG 8,000, and 0.5% ethyl acetate	Resolution 2.00 Å R-free 0.218
6OBM Ricin A chain bound to VHH antibody V6A7 Deposited 2019-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 40–298（259 aa） Fragment：Toxin catalytic subunit, residues 40-298	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；200 mM potassium sulfate and 20% PEG 3,350	Resolution 2.50 Å R-free 0.261
6OBO Ricin A chain bound to VHH antibody V6A6 Deposited 2019-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 40–296（257 aa） Fragment：Toxin catalytic subunit, residues 40-298	Not recorded	EDO 1,2-ETHANEDIOL × 1 ACY ACETIC ACID × 3 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；100 mM imidazole (pH 8.0), 200 mM calcium acetate, and 15% PEG 8,000	Resolution 1.90 Å R-free 0.244
6OBO Ricin A chain bound to VHH antibody V6A6 Deposited 2019-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 40–296（257 aa） Fragment：Toxin catalytic subunit, residues 40-298	Not recorded	EDO 1,2-ETHANEDIOL × 2 ACY ACETIC ACID × 3 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；100 mM imidazole (pH 8.0), 200 mM calcium acetate, and 15% PEG 8,000	Resolution 1.90 Å R-free 0.244
6OCA Ricin A chain bound to VHH antibody V2G10 Deposited 2019-03-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 38–302（265 aa） Fragment：Toxin catalytic subunit, residues 38-302	Not recorded	CL CHLORIDE ION × 2 PG4 TETRAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5；295 K；100 mM MES (pH 5.0) and 20% PEG 6,000	Resolution 2.11 Å R-free 0.246
6OCA Ricin A chain bound to VHH antibody V2G10 Deposited 2019-03-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 38–302（265 aa） Fragment：Toxin catalytic subunit, residues 38-302	Not recorded	CL CHLORIDE ION × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5；295 K；100 mM MES (pH 5.0) and 20% PEG 6,000	Resolution 2.11 Å R-free 0.246
6OCD Ricin A chain bound to VHH antibody V6D4 Deposited 2019-03-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 40–297（258 aa） Fragment：Toxin catalytic subunit, residues 40-297	Not recorded	ZN ZINC ION × 1 CL CHLORIDE ION × 1 IMD IMIDAZOLE × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；295 K；100 mM MES (pH 6.0), 400 mM zinc acetate, and 11% PEG 8,000	Resolution 2.10 Å R-free 0.228
6OCD Ricin A chain bound to VHH antibody V6D4 Deposited 2019-03-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 40–297（258 aa） Fragment：Toxin catalytic subunit, residues 40-297	Not recorded	ZN ZINC ION × 2 IMD IMIDAZOLE × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；295 K；100 mM MES (pH 6.0), 400 mM zinc acetate, and 11% PEG 8,000	Resolution 2.10 Å R-free 0.228
6URW Crystal structure of ricin A chain in complex with inhibitor 4-(2-thienylmethyl)benzoic acid Deposited 2019-10-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 22 DMS DIMETHYL SULFOXIDE × 1 R7T 4-[(thiophen-2-yl)methyl]benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；200 mM Sodium Acetate, 20% (w/v) PEG 3350	Resolution 2.40 Å R-free 0.235
6URX Crystal structure of ricin A chain in complex with inhibitor 5-phenyl-2-thiophenecarboxylic acid Deposited 2019-10-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 15 JMG 5-phenylthiophene-2-carboxylic acid × 1 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；200 mM Ammonium Iodide, 20% (w/v) PEG 3350	Resolution 1.99 Å R-free 0.218
6URY Crystal structure of ricin A chain in complex with inhibitor 9-oxo-4-fluorenecarboxamide Deposited 2019-10-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	R6T 9-oxo-9H-fluorene-4-carboxamide × 1 EDO 1,2-ETHANEDIOL × 17 CL CHLORIDE ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；100 mM Tris pH 7.0, 200 mM Magnesium Chloride, 2.5 M Sodium Chloride	Resolution 1.54 Å R-free 0.195
6URY Crystal structure of ricin A chain in complex with inhibitor 9-oxo-4-fluorenecarboxamide Deposited 2019-10-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 36–302（267 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；100 mM Tris pH 7.0, 200 mM Magnesium Chloride, 2.5 M Sodium Chloride	Resolution 1.54 Å R-free 0.195
7KBI Ricin bound to VHH antibody V5E1 Deposited 2020-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 36–302（267 aa） Chain B 315–576（262 aa）	Not recorded	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；340 mM ammonium fluoride and 22% PEG 3,350.	Resolution 3.05 Å R-free 0.274
7KBK Ricin bound to VHH antibody V6E11 Deposited 2020-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 36–302（267 aa） Chain B 315–576（262 aa）	Not recorded	SO4 SULFATE ION × 1 EDO 1,2-ETHANEDIOL × 3 CL CHLORIDE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；200 mM sodium chloride 100 mM CHES pH 9.5, and 1.26 M ammonium sulfate.	Resolution 2.09 Å R-free 0.203
7KC9 Ricin bound to VHH antibody V5G1 Deposited 2020-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 36–302（267 aa） Chain B 315–576（262 aa）	Not recorded	ZN ZINC ION × 4 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；293 K；200 mM zinc acetate, 20% PEG 3,350	Resolution 2.30 Å R-free 0.238
7KC9 Ricin bound to VHH antibody V5G1 Deposited 2020-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 36–302（267 aa） Chain E 315–576（262 aa）	Not recorded	ZN ZINC ION × 5 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；293 K；200 mM zinc acetate, 20% PEG 3,350	Resolution 2.30 Å R-free 0.238
7KD0 Ricin bound to VHH antibody V2C11 Deposited 2020-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 36–302（267 aa） Chain B 315–576（262 aa）	Not recorded	GAL beta-D-galactopyranose × 2 EDO 1,2-ETHANEDIOL × 2 ZN ZINC ION × 1 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；100 mM Zinc Acetate, 14% PEG 8,000, 22% Glycerol, 80 mM NaCaco pH 6.5, 3% D+Galactose	Resolution 2.77 Å R-free 0.255
7KD2 Ricin bound to VHH antibody V11B2 Deposited 2020-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 36–302（267 aa） Chain B 315–576（262 aa）	Not recorded	ZN ZINC ION × 5 CL CHLORIDE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；200 mM Zinc Acetate, 100 mM MES pH 6.0, 10% PEG 8,000	Resolution 2.55 Å R-free 0.280
7KDM Ricin bound to VHH antibody V5G6 Deposited 2020-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 315–576（262 aa）	Not recorded	ZN ZINC ION × 4 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；4 M Sodium Formate	Resolution 2.30 Å R-free 0.238
7KDM Ricin bound to VHH antibody V5G6 Deposited 2020-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 315–576（262 aa）	Not recorded	ZN ZINC ION × 5 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；4 M Sodium Formate	Resolution 2.30 Å R-free 0.238
7KDU Ricin bound to VHH antibody V5E4 Deposited 2020-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 36–302（267 aa） Chain B 315–576（262 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；290 mM zinc Aaetate and 17% PEG 3,350	Resolution 2.81 Å R-free 0.294
7MLN Crystal structure of ricin A chain in complex with 5-(o-tolyl)thiophene-2-carboxylic acid Deposited 2021-04-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	ZJA 5-(2-methylphenyl)thiophene-2-carboxylic acid × 1 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；24 %(w/v) PEG 1500, 20 %(w/v) Glycerol	Resolution 1.52 Å R-free 0.207
7MLO Crystal structure of ricin A chain in complex with 5-mesitylthiophene-2-carboxylic acid Deposited 2021-04-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	ZJ7 5-(2,4,6-trimethylphenyl)thiophene-2-carboxylic acid × 1 EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295 K；50 mM Bis-Tris pH 6.5, 50 mM Ammonium Sulfate, 30 %(v/v) Pentaerythritol Ethoxylate (15/4 EO/OH)	Resolution 1.65 Å R-free 0.237
7MLO Crystal structure of ricin A chain in complex with 5-mesitylthiophene-2-carboxylic acid Deposited 2021-04-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 36–302（267 aa）	Not recorded	ZJ7 5-(2,4,6-trimethylphenyl)thiophene-2-carboxylic acid × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295 K；50 mM Bis-Tris pH 6.5, 50 mM Ammonium Sulfate, 30 %(v/v) Pentaerythritol Ethoxylate (15/4 EO/OH)	Resolution 1.65 Å R-free 0.237
7MLP Crystal structure of ricin A chain in complex with 5-(2,6-dimethylphenyl)thiophene-2-carboxylic acid Deposited 2021-04-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	ZJ4 5-(2,6-dimethylphenyl)thiophene-2-carboxylic acid × 1 EDO 1,2-ETHANEDIOL × 6 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；295 K；100 mM Sodium Acetate pH 4.5, 200 mM Zinc Acetate, 10 %(w/v) PEG 3000	Resolution 1.78 Å R-free 0.213
7MLT Crystal structure of ricin A chain in complex with 5-(2-ethylphenyl)thiophene-2-carboxylic acid Deposited 2021-04-29	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	CL CHLORIDE ION × 3 EDO 1,2-ETHANEDIOL × 18 ZJD 5-(2-ethylphenyl)thiophene-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；295 K；100 mM Tris pH 8.5, 200 mM Magnesium Chloride, 16 %(w/v) PEG 4000	Resolution 1.80 Å R-free 0.203
7TGF Single-domain VHH intrabodies neutralize ricin toxin. Deposited 2022-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 CL CHLORIDE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；100 mM sodium citrate pH 4.0, 30% PEG 6000, and 1 M lithium chloride	Resolution 1.35 Å R-free 0.181
7TGI Single-domain VHH intrabodies neutralize ricin toxin Deposited 2022-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Not recorded	CL CHLORIDE ION × 5 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；200 mM magnesium chloride, 20% PEG 3350	Resolution 2.10 Å R-free 0.222
7TH2 Single-domain VHH intrabodies neutralize ricin toxin Deposited 2022-01-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Not recorded	CL CHLORIDE ION × 11 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；298 K；100 mM MES pH 6.5, 200 mM sodium thiocyanate, 8% dioxane, 1740 mM ammonium sulfate	Resolution 1.84 Å R-free 0.187
7TH2 Single-domain VHH intrabodies neutralize ricin toxin Deposited 2022-01-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 36–302（267 aa）	Not recorded	CL CHLORIDE ION × 10 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；298 K；100 mM MES pH 6.5, 200 mM sodium thiocyanate, 8% dioxane, 1740 mM ammonium sulfate	Resolution 1.84 Å R-free 0.187
7TH3 Single-domain VHH intrabodies neutralize ricin toxin Deposited 2022-01-10	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；418 mM ammonium chloride, 22% PEG 3350	Resolution 2.29 Å R-free 0.272
7XZS Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbonyl)-L-tyrosine Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	I8T (2S)-2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]-3-(4-hydroxyphenyl)propanoic acid × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, lithium sulfate, sodium acetate	Resolution 1.50 Å R-free 0.243
7XZT Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbonyl)-D-tyrosine Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	I9P (2R)-2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]-3-(4-hydroxyphenyl)propanoic acid × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.30 Å R-free 0.240
7XZU Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbonyl)-L-phenylalanine Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	IEK (2S)-2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]-3-phenyl-propanoic acid × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.60 Å R-free 0.220
7XZW Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbonyl)-D-phenylalanine Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	IEW (2R)-2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]-3-phenyl-propanoic acid × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.45 Å R-free 0.244
7Y02 Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7-carboxamido)-3-(4-fluorophenyl)propanoic acid Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	IEZ (2S)-2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]-3-(4-fluorophenyl)propanoic acid × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.60 Å R-free 0.223
7Y03 Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7-carboxamido)-2-phenylacetic acid Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	IF4 (2S)-2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]-2-phenyl-ethanoic acid × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.35 Å R-free 0.238
7Y05 Crystal structure of Ricin A chain bound with (R)-2-(2-amino-4-oxo-3,4-dihydropteridine-7-carboxamido)-2-phenylacetic acid Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	IFH (2R)-2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]-2-phenyl-ethanoic acid × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.60 Å R-free 0.231
7Y06 Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7-carboxamido)-4-phenylbutanoic acid Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	IFQ (2S)-2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]-4-phenyl-butanoic acid × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.35 Å R-free 0.235
7Y07 Crystal structure of Ricin A chain bound with (S)-2-amino-N-(1-hydroxy-3-phenylpropan-2-yl)-4-oxo-3,4-dihydropteridine-7-carboxamide Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	IFX 2-azanyl-4-oxidanylidene-N-[(2S)-1-oxidanyl-3-phenyl-propan-2-yl]-3H-pteridine-7-carboxamide × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.25 Å R-free 0.234
7Y08 Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbonyl)glycyl-L-phenylalanine Deposited 2022-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	RS8 N-[(2-amino-4-oxo-1,4-dihydropteridin-7-yl)carbonyl]glycyl-L-phenylalanine × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；296 K；Ammonium sulfate, Sodium malonate	Resolution 1.25 Å R-free 0.253
7Y4K Crystal structure of Ricin A chain bound with N2-(2-amino-4-oxo-3,4-dihydropteridine-7-carbonyl)glycyl-L-phenylalanyl-N6-((benzyloxy)carbonyl)-L-ornitine Deposited 2022-06-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	JKU (2S)-2-[[(2S)-2-[2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]ethanoylamino]-3-phenyl-propanoyl]amino]-5-(phenylmethoxycarbonylamino)pentanoic acid × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.70 Å R-free 0.230
7Y4M Crystal structure of Ricin A chain bound with N2-(2-amino-4-oxo-3,4-dihydropteridine-7-carbonyl)glycyl-L-phenylalanyl-N6-((benzyloxy)carbonyl)-L-lysine Deposited 2022-06-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	IWQ (2S)-2-[[(2S)-2-[2-[(2-azanyl-4-oxidanylidene-3H-pteridin-7-yl)carbonylamino]ethanoylamino]-3-phenyl-propanoyl]amino]-6-(phenylmethoxycarbonylamino)hexanoic acid × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG 2000, Lithium sulfate, Sodium acetate	Resolution 1.45 Å R-free 0.242
8I7P Crystal structure of Ricin A chain bound with N2-(2-amino-4-oxo-3,4-dihydropteridine-7-carbonyl)glycyl-L-tyrosine Deposited 2023-02-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 36–302（267 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；296 K；PEG2000, Lithium sulfate, Sodium acetate	Resolution 1.60 Å R-free 0.232
8T9V RTA-RUNT-59 complex structure Deposited 2023-06-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–296（258 aa）	Not recorded	ZJT (9aP)-7-fluoro-4,5-dihydronaphtho[1,2-b]thiophene-2-carboxylic acid × 1 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；200 mM di-Ammonium tartrate and 20% PEG 3350	Resolution 1.95 Å R-free 0.206
8TAB RTA-PD00589 Deposited 2023-06-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–296（258 aa）	Not recorded	CL CHLORIDE ION × 3 U4T 4H,5H-naphtho[1,2-b]thiophene-2-carboxylic acid × 1 EDO 1,2-ETHANEDIOL × 2 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；200 mM Mg(NO3)2 and 20% PEG 3350	Resolution 2.26 Å R-free 0.219
8TAD RTA in complex with inhibitor RUNT-206 Deposited 2023-06-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–293（255 aa）	Not recorded	ZXJ (9aM)-5,5-dimethyl-4,5-dihydronaphtho[1,2-b]thiophene-2-carboxylic acid × 1 CL CHLORIDE ION × 1 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；50 mM KH2PO4 and 20% PEG 8000	Resolution 2.76 Å R-free 0.256
8TFH Ricin in complex with Fab JB4 Deposited 2023-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 39–298（260 aa） Chain B 315–576（262 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 CL CHLORIDE ION × 3 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；1.5 M ammonium sulfate and 25% glycerol	Resolution 3.29 Å R-free 0.334
8TFL Ricin in complex with Fab SylH3 Deposited 2023-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 40–299（260 aa） Chain B 316–576（261 aa）	Not recorded	2PE NONAETHYLENE GLYCOL × 1 NDG 2-acetamido-2-deoxy-alpha-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；1.5 M ammonium fluoride and 20% PEG 3,350	Resolution 2.89 Å R-free 0.287
9E3T RTA-RUNT-165 complex Deposited 2024-10-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa） Fragment：residues 40-294	Not recorded	A1BH4 (5M)-5-(2-ethyl-6-methylphenyl)thiophene-2-carboxylic acid × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；100 mM Hepes pH 6.5 and 20% PEG 6000	Resolution 1.80 Å R-free 0.234
9E3T RTA-RUNT-165 complex Deposited 2024-10-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 36–302（267 aa） Fragment：residues 40-294	Not recorded	A1BH4 (5M)-5-(2-ethyl-6-methylphenyl)thiophene-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；100 mM Hepes pH 6.5 and 20% PEG 6000	Resolution 1.80 Å R-free 0.234
9E40 RTA-RUNT-202 complex Deposited 2024-10-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa）	Not recorded	A1BH3 5-(4-fluoro-2,6-dimethylphenyl)thiophene-2-carboxylic acid × 1 IMD IMIDAZOLE × 3 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 NI NICKEL (II) ION × 4 CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；Tris pH 7.0, 40% PEG 300, and 5% PEG 1000	Resolution 1.80 Å R-free 0.180
9E42 RTA-RUNT-192 complex Deposited 2024-10-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 36–302（267 aa） Fragment：residues 40-294	Not recorded	A1BH2 5-(2,6-diethylphenyl)thiophene-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；170 mM diammonium hydrogen phosphate	Resolution 1.80 Å R-free 0.246
9E42 RTA-RUNT-192 complex Deposited 2024-10-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 36–302（267 aa） Fragment：residues 40-294	Not recorded	A1BH2 5-(2,6-diethylphenyl)thiophene-2-carboxylic acid × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；170 mM diammonium hydrogen phosphate	Resolution 1.80 Å R-free 0.246

100 other PDB entries and 125 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RICI_RICCO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–267； UniProt 36–302 Author chain I； PDBConstruct 1–267； UniProt 36–302

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4kuc
Deposition date deposition_date	2013-05-21
Structure title title	Crystal structure of ricin-A chain in complex with the antibody 6C2
Keywords keywords	RNA-N-glycosidase, HYDROLASE-IMMUNE SYSTEM complex; HYDROLASE/IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	37.12 Å
Radius of gyration Rg (electron density) rg_electron	36.81 Å
Forward intensity I(0) i0	217899000.00
Molecular weight molecular_weight	116950.0 kDa
Excluded volume excluded_volume	145270 Å³
Envelope volume envelope_volume	203620 Å³
Hydration-shell volume shell_volume	47941 Å³
Envelope diameter envelope_diameter	118.2 Å
Shell Rg shell_rg	41.43 Å
Envelope Rg envelope_rg	35.95 Å
Shape Rg shape_rg	36.76 Å
Total Rg total_rg	37.30 Å
Total atoms total_atoms	8287
Residues n_residues	1156
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	120.6 Å
Rg (real space) rg_real	37.16 Å
Rg uncertainty (real space) rg_real_error	0.80 Å
I(0) (real space) i0_real	2.1790e+08
I(0) uncertainty (real space) i0_real_error	3.5510e+06
Rg (reciprocal space) rg_reciprocal	37.14 Å
I(0) (reciprocal space) i0_reciprocal	217900000.0000
Solution quality estimate total_estimate	0.6314
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	44.9 Å
Skewness Skewness skewness	0.345
Kurtosis Kurtosis kurtosis	-0.426
Angular range angular_range	— – 0.2150 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	23950000.0000
Real-space data points n_real_points	44
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.916; Stabil: 1.000; Sysdev: 0.159; Positv: 1.000; Valcen: 0.979; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Ricin
Molecular weight formula_weight	29936.8 kDa
EC 编号 ec_number	3.2.2.22
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,I
Atom count atom_count	8287

IFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQF

来源 Source

来源生物 organism	Ricinus communis
通用名 common_name	Castor bean
NCBI Class编号 ncbi_taxonomy_id	3988
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	mAb6c2 fab-Heavy chain
Molecular weight formula_weight	25401.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E

METDTLLLWVLLLWVPGSTGDIVLTQSPASLAVSLGQRATISYRASKSVSYMHWNQQKPGQPPRLLIYLGSNLESGVGARFSGSGSGTDFTLNIHPVEEEDAATYYCQHKREYPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVGNLQGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

来源 Source

来源生物 organism	Mus musculus
NCBI Class编号 ncbi_taxonomy_id	10090

Entity 3 Entity 3 polymer

Description description	mAb6c2 fab-Light chain
Molecular weight formula_weight	25257.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,F

MGWSSIILFLVATASGVHSQVQLQQPGSELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPGSGRTNYDEKFKNKATLTVDTSSSTVYIQVSSLTSEDAAVFYCVRWVYGNFDSALDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWGSGASGVHTFPAVLQSSGLYSLSSVVTVPSSSLGQTYICNVNHKPSNTKVDKKVEP

来源 Source

来源生物 organism	Mus musculus
NCBI Class编号 ncbi_taxonomy_id	10090

▼

7. Fold Classification (SCOP + CATH) 17 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d4kuca_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.165 — Ribosome inactivating proteins (RIP)
Superfamily Superfamily superfamily	d.165.1 — Ribosome inactivating proteins (RIP)
Family Family family	d.165.1.1 — Plant cytotoxins

Domain ID domain_id	d4kucd1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d4kucd2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d4kuce_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d4kucf_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d4kuch_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d4kuci_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.165 — Ribosome inactivating proteins (RIP)
Superfamily Superfamily superfamily	d.165.1 — Ribosome inactivating proteins (RIP)
Family Family family	d.165.1.1 — Plant cytotoxins

CATH v4.4 (10 domains)

Domain ID domain_id	4kucA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	420 — Ricin (A subunit); domain 1
Homologous superfamily homologous superfamily	10 — Ricin (A subunit), domain 1

Domain ID domain_id	4kucA02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	470 — Ricin (A Subunit), domain 2
Homologous superfamily homologous superfamily	10 — Ricin (A Subunit), domain 2

Domain ID domain_id	4kucD01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4kucD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4kucE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4kucF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4kucH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4kucH02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4kucI01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	420 — Ricin (A subunit); domain 1
Homologous superfamily homologous superfamily	10 — Ricin (A subunit), domain 1

Domain ID domain_id	4kucI02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	470 — Ricin (A Subunit), domain 2
Homologous superfamily homologous superfamily	10 — Ricin (A Subunit), domain 2

▶

8. Citations (1)

▶

Unit-cell length a length_a	108.516 Å
Unit-cell length b length_b	151.803 Å
Unit-cell length c length_c	208.418 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	2.787 Å
Low-resolution limit resolution_low	36.436 Å
R factor r_factor	0.2409
R_work r_work	0.2384
R_free r_free	0.2889

fit	/app/data/saxs_computation/ku/4kuc/4kuc.fit
pddf	/app/data/pr_computation/ku/4kuc/4kuc.pr.out
profile	/app/data/saxs_computation/ku/4kuc/4kuc.dat

Crystal structure of ricin-A chain in complex with the antibody 6C2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ricin

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 17 domains

SCOP 2.08 (7 domains)

CATH v4.4 (10 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)