4m77

Crystal structure of Lsm2-8 complex, space group I212121

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U6 snRNA-associated Sm-like protein LSm8

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–109； UniProt 1–109 Author chain H； PDBConstruct 1–109； UniProt 1–109

U6 snRNA-associated Sm-like protein LSm2

Saccharomyces cerevisiae

UniProt P38203

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–95； UniProt 1–95 Author chain I； PDBConstruct 1–95； UniProt 1–95

U6 snRNA-associated Sm-like protein LSm3

Saccharomyces cerevisiae

UniProt P57743

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–89； UniProt 1–89 Author chain J； PDBConstruct 1–89； UniProt 1–89

U6 snRNA-associated Sm-like protein LSm6

Saccharomyces cerevisiae

UniProt Q06406

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–86； UniProt 1–86 Author chain K； PDBConstruct 1–86； UniProt 1–86

U6 snRNA-associated Sm-like protein LSm5

Saccharomyces cerevisiae

UniProt P40089

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–93； UniProt 1–93 Author chain L； PDBConstruct 1–93； UniProt 1–93

U6 snRNA-associated Sm-like protein LSm7

Saccharomyces cerevisiae

UniProt P53905

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–115； UniProt 1–115 Author chain M； PDBConstruct 1–115； UniProt 1–115

U6 snRNA-associated Sm-like protein LSm4

Saccharomyces cerevisiae

UniProt P40070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–93； UniProt 1–93 Author chain N； PDBConstruct 1–93； UniProt 1–93

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4m77
Deposition date deposition_date	2013-08-12
Structure title title	Crystal structure of Lsm2-8 complex, space group I212121
Keywords keywords	Sm Like protein, RNA splicing, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4m77__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4m77__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4m77__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.07 Å
Rg (electron density)	24.79 Å
Total Rg	25.70 Å
Atom count	4116
Residues	523
Excluded volume	74340 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4m77__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4m77__assembly_2__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	U6 snRNA-associated Sm-like protein LSm8
Molecular weight formula_weight	12355.2 kDa
Mutation mutation	K17L,C22S,I38L,C51S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,H
Atom count atom_count	8312

MSATLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLIDAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKVYESKTK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	U6 snRNA-associated Sm-like protein LSm2
Molecular weight formula_weight	11161.8 kDa
Mutation mutation	C45S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,I

MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	U6 snRNA-associated Sm-like protein LSm3
Molecular weight formula_weight	10007.1 kDa
Mutation mutation	C37S,C63S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,J

METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTPSEDDDGAVEI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	U6 snRNA-associated Sm-like protein LSm6
Molecular weight formula_weight	9406.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,K

MSGKASTEGSVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	U6 snRNA-associated Sm-like protein LSm5
Molecular weight formula_weight	10433.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,L

MSLPEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKKTPTEAL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	U6 snRNA-associated Sm-like protein LSm7
Molecular weight formula_weight	13027.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,M

MHQQHSKSENKPQQQRKKFEGPKREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNPDDENNTELISKNARKLGLTVIRGTILVSLSSAEGSDVLYMQK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	U6 snRNA-associated Sm-like protein LSm4
Molecular weight formula_weight	10627.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,N

MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 26 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d4m77b_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77c_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77d_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77e_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77f_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77g_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77i_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77j_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77k_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77l_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77m_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

Domain ID domain_id	d4m77n_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.0 — automated matches

CATH v4.4 (14 domains)

Domain ID domain_id	4m77A00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77B00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77C00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77D00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77F00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77G00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77H00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77I00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77J00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77K00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77L00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77M00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	4m77N00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

▶

Unit-cell length a length_a	139.103 Å
Unit-cell length b length_b	145.878 Å
Unit-cell length c length_c	149.279 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	I 21 21 21
Space-group number int_tables_number	24
Crystal system crystal_system	—

Resolution resolution	3.111 Å
Low-resolution limit resolution_low	29.979 Å
R factor r_factor	0.2477
R_work r_work	0.2466
R_free r_free	0.2672

Crystal structure of Lsm2-8 complex, space group I212121

1. Protein Identity and Related Structures Protein Identity & Related Structures

U6 snRNA-associated Sm-like protein LSm8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4m77__assembly_1__model_1

4m77__assembly_1__model_1 | I(q)

4m77__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer