3jcm

Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-splicing factor 8

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–2413； UniProt 1–2413

U4/U6 small nuclear ribonucleoprotein PRP4

OrganismNot specified

UniProt P20053

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–465； UniProt 1–465

Pre-mRNA-processing factor 31

OrganismNot specified

UniProt P49704

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–494； UniProt 1–494

Pre-mRNA-splicing factor 6

OrganismNot specified

UniProt P19735

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP6_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–899； UniProt 1–899

U4/U6 small nuclear ribonucleoprotein PRP3

OrganismNot specified

UniProt Q03338

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP3_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain K； PDBConstruct 1–469； UniProt 1–469

Spliceosomal protein DIB1

OrganismNot specified

UniProt Q06819

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DIB1_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–143； UniProt 1–143

13 kDa ribonucleoprotein-associated protein

OrganismNot specified

UniProt P39990

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNU13_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–126； UniProt 1–126

Pre-mRNA-splicing factor SNU114

OrganismNot specified

UniProt P36048

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SN114_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–1008； UniProt 1–1008

Pre-mRNA-splicing helicase BRR2

OrganismNot specified

UniProt P32639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BRR2_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain N； PDBConstruct 1–2163； UniProt 1–2163

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P43321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–101； UniProt 1–101 Author chain R； PDBConstruct 1–101； UniProt 1–101

Small nuclear ribonucleoprotein-associated protein B

OrganismNot specified

UniProt P40018

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–196； UniProt 1–196 Author chain S； PDBConstruct 1–196； UniProt 1–196

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt Q02260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–146； UniProt 1–146 Author chain T； PDBConstruct 1–146； UniProt 1–146

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt Q06217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–110； UniProt 1–110 Author chain U； PDBConstruct 1–110； UniProt 1–110

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt Q12330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain V； PDBConstruct 1–94； UniProt 1–94 Author chain Y； PDBConstruct 1–94； UniProt 1–94

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P54999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain W； PDBConstruct 1–86； UniProt 1–86 Author chain Z； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P40204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain X； PDBConstruct 1–77； UniProt 1–77 Author chain a； PDBConstruct 1–77； UniProt 1–77

U6 snRNA-associated Sm-like protein LSm8

OrganismNot specified

UniProt P47093

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain b； PDBConstruct 1–109； UniProt 1–109

U6 snRNA-associated Sm-like protein LSm2

OrganismNot specified

UniProt P38203

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain c； PDBConstruct 1–95； UniProt 1–95

U6 snRNA-associated Sm-like protein LSm3

OrganismNot specified

UniProt P57743

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain d； PDBConstruct 1–89； UniProt 1–89

U6 snRNA-associated Sm-like protein LSm6

OrganismNot specified

UniProt Q06406

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain e； PDBConstruct 1–86； UniProt 1–86

U6 snRNA-associated Sm-like protein LSm5

OrganismNot specified

UniProt P40089

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain f； PDBConstruct 1–93； UniProt 1–93

U6 snRNA-associated Sm-like protein LSm7

OrganismNot specified

UniProt P53905

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain g； PDBConstruct 1–115； UniProt 1–115

U6 snRNA-associated Sm-like protein LSm4

OrganismNot specified

UniProt P40070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 4	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） pre-mRNA × 1 SNR6 snRNA × 1 SNR14 snRNA × 1 SNR7-L snRNA × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_YEAST
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain h； PDBConstruct 1–187； UniProt 1–187

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3jcm
Deposition date deposition_date	2015-12-23
Structure title title	Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP
Keywords keywords	U4/U6.U5 tri-snRNP, pre-mRNA, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3jcm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3jcm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3jcm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	92.52 Å
Rg (electron density)	88.36 Å
Total Rg	86.83 Å
Atom count	58253
Residues	8679
Excluded volume	960510 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3jcm__assembly_1__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	Pre-mRNA-splicing factor 8
Molecular weight formula_weight	279867.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	58253

MSGLPPPPPGFEEDSDLALPPPPPPPPGYEIEELDNPMVPSSVNEDTFLPPPPPPPSNFEINAEEIVDFTLPPPPPPPGLDELETKAEKKVELHGKRKLDIGKDTFVTRKSRKRAKKMTKKAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTSGAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINLPLDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFFNGKALNNAIPGGPKFEPLYPREEEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPVSCIIQNDEEYDTPALFFDPSLNPIPHFIDNNSSLNVSNTKENGDFTLPEDFAPLLAEEEELILPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQLADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWRVWLNFLRGTIPLLERYIGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESIRQKKARTILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHVEKTMVKKNLGRLTRLWIKNEQERQRQIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPFPPLTYKNDTKILVLALEDLKDVYASKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDITMMENYQNISPVYSVDPLEKITDAYLDQYLWYEADQRKLFPNWIKPSDSEIPPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTLGEMAEKIDFTLLNRLLRLIVDPNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDLAGPANNPNEFMQFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPNFENSIGYNNRKCWPKDSRMRLIRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLFSMCGFEVRILPRQRMEEVVSNDEGVWDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGILMASGSTTFTKVAAKWNTSLISLFTYFREAIVATEPLLDILVKGETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRVWAEYATKRQEAIQQNRRLAFEELEGSWDRGIPRISTLFQRDRHTLAYDRGHRIRREFKQYSLERNSPFWWTNSHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFNSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGELDVLQIESVTKETVHPRKSYKMNSSAADITMESVHEWEVSKPSLLHETNDSFKGLITNKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFNGLKPLIQNSMRTIMKANPALYVLRERIRKGLQIYQSSVQEPFLNSSNYAELFNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPTELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNEESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILTEYGRKYNVNISALTQTEIKDIILGQNIKAPSVKRQKMAELEAARSEKQNDEEAAGASTVMKTKTINAQGEEIVVVASADYESQTFSSKNEWRKSAIANTLLYLRLKNIYVSADDFVEEQNVYVLPKNLLKKFIEISDVKIQVAAFIYGMSAKDHPKVKEIKTVVLVPQLGHVGSVQISNIPDIGDLPDTEGLELLGWIHTQTEELKFMAASEVATHSKLFADKKRDCIDISIFSTPGSVSLSAYNLTDEGYQWGEENKDIMNVLSEGFEPTFSTHAQLLLSDRITGNFIIPSGNVWNYTFMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQFSELAGDEELEAEQIDVFS

Entity 2 Entity 2 polymer

Description description	U4/U6 small nuclear ribonucleoprotein PRP4
Molecular weight formula_weight	52507.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSKYIALENLPVDLQHKGATQNESTADILKQLPHERLQAVLEKIPEEDLEVRRLLSILKKPEVVENEDVQQRRIRLAEILMVDEIDLENINNMENINGEEVDEEDDEDFFTPATSELIFARRFLINYSLERSRKRLQKEMERHQKFNTRQELLSRRTELQRMANLELAGSQLVSTKPISAVSLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN

Entity 3 Entity 3 polymer

Description description	Pre-mRNA-processing factor 31
Molecular weight formula_weight	56382.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSSEEDYFDELEYDLADEVNEEKEDIQTKKLTTVNCQTEKFNPFEILPESIELFRTLALISPDRLSLSETAQILPKIVDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRISEANQQADEFLISLGHNTEQPNLSPEMVQMHKKQHTNPEEETNWFSGHG

Entity 4 Entity 4 polymer

Description description	Pre-mRNA-splicing factor 6
Molecular weight formula_weight	104370.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MERPSFLDQEPPAGYVPGIGRGATGFSTKEKQVVSNDDKGRRIPKRYRENLNNHLQSQPKDDEDDEAANVFKTLELKLAQKKKKRANEKDDDNSVDSSNVKRQFADLKESLAAVTESEWMDIPDATDFTRRNKRNRIQEQLNRKTYAAPDSLIPGNVDLNKLTEEREKLLQSQIDENLAQLTKNASNPIQVNKPNAATDALSYLKDLENDRVNSLSDATLEDLQKMRTILKSYRKADPTNPQGWIASARLEEKARKFSVAKKIIENGCQECPRSSDIWLENIRLHESDVHYCKTLVATAINFNPTSPLLWFKAIDLESTTVNKYRVVRKALQEIPRDEGLWKLAVSFEADKAQVIKMLEKATQFIPQSMDLLTAYTNLQSYHNAKMTLNSFRKILPQEPEIWIISTLLEERNNPDIPVDKLVSLLKEGLLELSKNGYKATLSAWLKRAEALNDAPNSNLTCQAIVYAILEWLRESGEYESELNNVDQILEKMPHSKVQIAVLKKLIQWDPCDTVLWSRLKMATESYHKIEELLAFFQELLFQTKNSDDIRANMREKSPGLLMMYVSEYWKAQKGDTRQTLVLIDQIIDFAPHNLDLRFFKIKLLGRSLQLDELRDFFQQTFSSLEDFKISGTERLYYKYVNFLRYQDLNEEAIKFLNERCLKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLVPNCPLLWVSLSKIDEIDLKNPVRARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPSNALLWVEQIKLFKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAEAQYETSLKWLERALKKCSRYGDTWVWLFRTYARLGKDTVDLYNMFDQCEPTYGPEWIAASKNVKMQYCTPREILLRLMNDK

Entity 5 Entity 5 polymer

Description description	U4/U6 small nuclear ribonucleoprotein PRP3
Molecular weight formula_weight	55974.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MPPRNTYEKGNPKRQNSPYYKPSFLRREETTNDEEKFQGHGLKTELHSALKSSNLNLIRRTYQTGENPYLSDPHDRGSSSRFNRRYERGLKFYQKGEISKRIAQERTLQKQQEEEELKRKLKQEEDEKDKRKLIESGDLPNLELHEDKFLLDLSKFKIYYDNNHGYEWWDTAYLDEKGELMEKYDMNGTSPAEEKLAEDIDEVDDDDDDEHPSIRYVAHPLPEKINEAKVSIKAYLTQHERKRLRRNRRKMAREAREIKIKLGLLPKPEPKVKLSNMMSVFENDQNITDPTAWEKVVKDQVDLRKRKHLEENERRHEDAIKRRKEAVNMNVEKPTVYHCKVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEKSCKFYENLVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQDSLLRTLGQFDSEHFYSPVQT

Entity 6 Entity 6 polymer

Description description	Spliceosomal protein DIB1
Molecular weight formula_weight	16798.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKRVS

Entity 7 Entity 7 polymer

Description description	13 kDa ribonucleoprotein-associated protein
Molecular weight formula_weight	13582.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI

Entity 8 Entity 8 polymer

Description description	Pre-mRNA-splicing factor SNU114
Molecular weight formula_weight	114174.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEGDDLFDEFGNLIGVDPFDSDEEESVLDEQEQYQTNTFEGSGNNNEIESRQLTSLGSKKELGISLEHPYGKEVEVLMETKNTQSPQTPLVEPVTERTKLQEHTIFTQLKKNIPKTRYNRDYMLSMANIPERIINVGVIGPLHSGKTSLMDLLVIDSHKRIPDMSKNVELGWKPLRYLDNLKQEIDRGLSIKLNGSTLLCTDLESKSRMINFLDAPGHVNFMDETAVALAASDLVLIVIDVVEGVTFVVEQLIKQSIKNNVAMCFVINKLDRLILDLKLPPMDAYLKLNHIIANINSFTKGNVFSPIDNNIIFASTKLGFTFTIKEFVSYYYAHSIPSSKIDDFTTRLWGSVYYHKGNFRTKPFENVEKYPTFVEFILIPLYKIFSYALSMEKDKLKNLLRSNFRVNLSQEALQYDPQPFLKHVLQLIFRQQTGLVDAITRCYQPFELFDNKTAHLSIPGKSTPEGTLWAHVLKTVDYGGAEWSLVRIYSGLLKRGDTVRILDTSQSESRQKRQLHDISKTETSNEDEDEDDETPSCEVEEIGLLGGRYVYPVHEAHKGQIVLIKGISSAYIKSATLYSVKSKEDMKQLKFFKPLDYITEAVFKIVLQPLLPRELPKLLDALNKISKYYPGVIIKVEESGEHVILGNGELYMDCLLYDLRASYAKIEIKISDPLTVFSESCSNESFASIPVSNSISRLGEENLPGLSISVAAEPMDSKMIQDLSRNTLGKGQNCLDIDGIMDNPRKLSKILRTEYGWDSLASRNVWSFYNGNVLINDTLPDEISPELLSKYKEQIIQGFYWAVKEGPLAEEPIYGVQYKLLSISVPSDVNIDVMKSQIIPLMKKACYVGLLTAIPILLEPIYEVDITVHAPLLPIVEELMKKRRGSRIYKTIKVAGTPLLEVRGQVPVIESAGFETDLRLSTNGLGMCQLYFWHKIWRKVPGDVLDKDAFIPKLKPAPINSLSRDFVMKTRRRKGISTGGFMSNDGPTLEKYISAELYAQLRENGLVP

Entity 9 Entity 9 polymer

Description description	Pre-mRNA-splicing helicase BRR2
Molecular weight formula_weight	246470.3 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MTEHETKDKAKKIREIYRYDEMSNKVLKVDKRFMNTSQNPQRDAEISQPKSMSGRISAKDMGQGLCNNINKGLKENDVAVEKTGKSASLKKIQQHNTILNSSSDFRLHYYPKDPSNVETYEQILQWVTEVLGNDIPHDLIIGTADIFIRQLKENEENEDGNIEERKEKIQHELGINIDSLKFNELVKLMKNITDYETHPDNSNKQAVAILADDEKSDEEEVTEMSNNANVLGGEINDNEDDDEEYDYNDVEVNSKKKNKRALPNIENDIIKLSDSKTSNIESVPIYSIDEFFLQRKLRSELGYKDTSVIQDLSEKILNDIETLEHNPVALEQKLVDLLKFENISLAEFILKNRSTIFWGIRLAKSTENEIPNLIEKMVAKGLNDLVEQYKFRETTHSKRELDSGDDQPQSSEAKRTKFSNPAIPPVIDLEKIKFDESSKLMTVTKVSLPEGSFKRVKPQYDEIHIPAPSKPVIDYELKEITSLPDWCQEAFPSSETTSLNPIQSKVFHAAFEGDSNMLICAPTGSGKTNIALLTVLKALSHHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSRKQIDETQVLVSTPEKWDITTRNSNNLAIVELVRLLIIDEIHLLHDDRGPVLESIVARTFWASKYGQEYPRIIGLSATLPNYEDVGRFLRVPKEGLFYFDSSFRPCPLSQQFCGIKERNSLKKLKAMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLKNKFAEENITHKLTKNDAGSKQILKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPRYDTFGEGIIITDQSNVQYYLSVLNQQLPIESQFVSKLVDNLNAEVVAGNIKCRNDAVNWLAYTYLYVRMLASPMLYKVPDISSDGQLKKFRESLVHSALCILKEQELVLYDAENDVIEATDLGNIASSFYINHASMDVYNRELDEHTTQIDLFRIFSMSEEFKYVSVRYEEKRELKQLLEKAPIPIREDIDDPLAKVNVLLQSYFSQLKFEGFALNSDIVFIHQNAGRLLRAMFEICLKRGWGHPTRMLLNLCKSATTKMWPTNCPLRQFKTCPVEVIKRLEASTVPWGDYLQLETPAEVGRAIRSEKYGKQVYDLLKRFPKMSVTCNAQPITRSVMRFNIEIIADWIWDMNVHGSLEPFLLMLEDTDGDSILYYDVLFITPDIVGHEFTLSFTYELKQHNQNNLPPNFFLTLISENWWHSEFEIPVSFNGFKLPKKFPPPTPLLENISISTSELGNDDFSEVFEFKTFNKIQSQVFESLYNSNDSVFVGSGKGTGKTAMAELALLNHWRQNKGRAVYINPSGEKIDFLLSDWNKRFSHLAGGKIINKLGNDPSLNLKLLAKSHVLLATPVQFELLSRRWRQRKNIQSLELMIYDDAHEISQGVYGAVYETLISRMIFIATQLEKKIRFVCLSNCLANARDFGEWAGMTKSNIYNFSPSERIEPLEINIQSFKDVEHISFNFSMLQMAFEASAAAAGNRNSSSVFLPSRKDCMEVASAFMKFSKAIEWDMLNVEEEQIVPYIEKLTDGHLRAPLKHGVGILYKGMASNDERIVKRLYEYGAVSVLLISKDCSAFACKTDEVIILGTNLYDGAEHKYMPYTINELLEMVGLASGNDSMAGKVLILTSHNMKAYYKKFLIEPLPTESYLQYIIHDTLNNEIANSIIQSKQDCVDWFTYSYFYRRIHVNPSYYGVRDTSPHGISVFLSNLVETCLNDLVESSFIEIDDTEAEVTAEVNGGDDEATEIISTLSNGLIASHYGVSFFTIQSFVSSLSNTSTLKNMLYVLSTAVEFESVPLRKGDRALLVKLSKRLPLRFPEHTSSGSVSFKVFLLLQAYFSRLELPVDFQNDLKDILEKVVPLINVVVDILSANGYLNATTAMDLAQMLIQGVWDVDNPLRQIPHFNNKILEKCKEINVETVYDIMALEDEERDEILTLTDSQLAQVAAFVNNYPNVELTYSLNNSDSLISGVKQKITIQLTRDVEPENLQVTSEKYPFDKLESWWLVLGEVSKKELYAIKKVTLNKETQQYELEFDTPTSGKHNLTIWCVCDSYLDADKELSFEINVK

Entity 10 Entity 10 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	11240.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,J

MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR

Entity 11 Entity 11 polymer

Description description	Small nuclear ribonucleoprotein-associated protein B
Molecular weight formula_weight	22427.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,O

MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK

Entity 12 Entity 12 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	16296.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,P

MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL

Entity 13 Entity 13 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	12876.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,Q

MSSQIIDRPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTPVE

Entity 14 Entity 14 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10385.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,Y

MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD

Entity 15 Entity 15 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9669.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,Z

MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN

Entity 16 Entity 16 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8490.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,a

MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI

Entity 17 Entity 17 polymer

Description description	U6 snRNA-associated Sm-like protein LSm8
Molecular weight formula_weight	12403.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLIDAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKVYESKTK

Entity 18 Entity 18 polymer

Description description	U6 snRNA-associated Sm-like protein LSm2
Molecular weight formula_weight	11177.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK

Entity 19 Entity 19 polymer

Description description	U6 snRNA-associated Sm-like protein LSm3
Molecular weight formula_weight	10039.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPSEDDDGAVEI

Entity 20 Entity 20 polymer

Description description	U6 snRNA-associated Sm-like protein LSm6
Molecular weight formula_weight	9406.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MSGKASTEGSVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI

Entity 21 Entity 21 polymer

Description description	U6 snRNA-associated Sm-like protein LSm5
Molecular weight formula_weight	10433.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MSLPEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKKTPTEAL

Entity 22 Entity 22 polymer

Description description	U6 snRNA-associated Sm-like protein LSm7
Molecular weight formula_weight	13027.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MHQQHSKSENKPQQQRKKFEGPKREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNPDDENNTELISKNARKLGLTVIRGTILVSLSSAEGSDVLYMQK

Entity 23 Entity 23 polymer

Description description	U6 snRNA-associated Sm-like protein LSm4
Molecular weight formula_weight	21298.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQINSNNNSNSNGPGHKRYYNNRDSNNNRGNYNRRNNNNGNSNRRPYSQNRQYNNSNSSNINNSINSINSNNQNMNNGLGGSVQHHFNSSSPQKVEF

Entity 24 Entity 24 polymer

Description description	pre-mRNA
Molecular weight formula_weight	6425.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	C

AAAAAAUUAAGGUAUGUAUU

Entity 25 Entity 25 polymer

Description description	SNR6 snRNA
Molecular weight formula_weight	35883.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	D

GUUCGCGAAGUAACCCUUCGUGGACAUUUGGUCAAUUUGAAACAAUACAGAGAUGAUCAGCAGUUCCCCUGCAUAAGGAUGAACCGUUUUACAAAGAGAUUUAUUUCGUUUU

Entity 26 Entity 26 polymer

Description description	SNR14 snRNA
Molecular weight formula_weight	51186.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E

AUCCUUAUGCACGGGAAAUACGCAUAUCAGUGAGGAUUCGUCCGAGAUUGUGUUUUUGCUGGUUGAAAUUUAAUUAUAAACCAGACCGUCUCCUCAUGGUCAAUUCGGUGUUCGCUUUUGAAUACUUCAAGACUAUGUAGGGAAUUUUUGGAAUACCUUU

Entity 27 Entity 27 polymer

Description description	SNR7-L snRNA
Molecular weight formula_weight	68643.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	F

AAGCAGCUUUACAGAUCAAUGGCGGAGGGAGGUCAACAUCAAGAACUGUGGGCCUUUUAUUGCCUAUAGAACUUAUAACGAACAUGGUUCUUGCCUUUUACCAGAACCAUCCGGGUGUUGUCUCCAUAGAAACAGGUAAAGCUGUCCGUUACUGUGGGCUUGCCAUAUUUUUUGGAACUUUUCUGCCCUUUUUCUCAAUGAGUAAGGAGGGCGU

Entity 28 Entity 28 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ;
Molecular weight formula_weight	487.3 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 47 domains

SCOP 2.08 (13 domains)

Domain ID domain_id	d3jcmj_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmo_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmp_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmq_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmr_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcms_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmt_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmu_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmv_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmw_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmx_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmy_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

Domain ID domain_id	d3jcmz_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.1 — Sm motif of small nuclear ribonucleoproteins, SNRNP

CATH v4.4 (34 domains)

Domain ID domain_id	3jcmH04
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	870 — Elongation Factor G (Translational Gtpase), domain 3

Domain ID domain_id	3jcmJ00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmL00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	3jcmM00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/S12

Domain ID domain_id	3jcmN01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	3jcmN02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	3jcmN03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3jcmN04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3380 — Sec63 N-terminal domain-like fold
Homologous superfamily homologous superfamily	10 — Sec63 N-terminal domain-like domain

Domain ID domain_id	3jcmN05
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	20 — 5' to 3' exonuclease, C-terminal subdomain

Domain ID domain_id	3jcmN06
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	150 — C2 domain

Domain ID domain_id	3jcmN07
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	3jcmN08
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	3jcmN09
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3jcmN10
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3380 — Sec63 N-terminal domain-like fold
Homologous superfamily homologous superfamily	10 — Sec63 N-terminal domain-like domain

Domain ID domain_id	3jcmN11
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	20 — 5' to 3' exonuclease, C-terminal subdomain

Domain ID domain_id	3jcmN12
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	150 — C2 domain

Domain ID domain_id	3jcmP00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmQ00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmR00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmT00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmU00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmV00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmW00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmX00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmY00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmZ00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcma00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmb00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmc00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmd00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcme00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmf00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmg00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3jcmh00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	172134

Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein PRP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing factor 31

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein PRP3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spliceosomal protein DIB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

13 kDa ribonucleoprotein-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor SNU114

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing helicase BRR2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer