5gam

Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-splicing factor 8

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor SNU114 × 1 （P36048） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–735； UniProt 1–735

Pre-mRNA-splicing factor SNU114

OrganismNot specified

UniProt P36048

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor 8 × 1 （P33334） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SN114_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–1008； UniProt 1–1008

Small nuclear ribonucleoprotein-associated protein B

OrganismNot specified

UniProt P40018

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-splicing factor SNU114 × 1 （P36048） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain b； PDBConstruct 1–196； UniProt 1–196

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt Q12330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-splicing factor SNU114 × 1 （P36048） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain e； PDBConstruct 1–94； UniProt 1–94

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P54999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-splicing factor SNU114 × 1 （P36048） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein G × 1 （P40204） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain f； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P40204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-splicing factor SNU114 × 1 （P36048） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain g； PDBConstruct 1–77； UniProt 1–77

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P43321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-splicing factor SNU114 × 1 （P36048） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain d； PDBConstruct 1–101； UniProt 1–101

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt Q02260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-splicing factor SNU114 × 1 （P36048） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain h； PDBConstruct 1–146； UniProt 1–146

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt Q06217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	U5 snRNA × 1 Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-splicing factor SNU114 × 1 （P36048） ;U6 snRNA, 5' end ; × 1 Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Unknown polypeptide × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） GUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain j； PDBConstruct 1–110； UniProt 1–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5gam
Deposition date deposition_date	2015-12-15
Structure title title	Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP
Keywords keywords	Transcription, pre-mRNA splicing, snRNP, GTPase, U5 snRNA, Prp8, spliceosome; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5gam__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5gam__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5gam__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.05 Å
Rg (electron density)	46.94 Å
Total Rg	47.15 Å
Atom count	19123
Residues	2186
Excluded volume	331040 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5gam__assembly_1__model_1`	Dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	U5 snRNA
Molecular weight formula_weight	57138.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	U
Atom count atom_count	19123

AAGCAGCUUUACAGAUCAAUGGCGGAGGGAGGUCAACAUCAAGAACUGUGGGCCUUUUAUUGCCUAUAGAACUUAUAACGAACAUGGUUCUUGCCUUUUACCAGAACCAUCCGGGUGUUGUCUCCAUAGAAACAGGUAAAGCUGUCCGUUACUGUGGGCUUGCCAUAUUUUUUGGAAC

Entity 2 Entity 2 polymer

Description description	Pre-mRNA-splicing factor 8
Molecular weight formula_weight	85826.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSGLPPPPPGFEEDSDLALPPPPPPPPGYEIEELDNPMVPSSVNEDTFLPPPPPPPSNFEINAEEIVDFTLPPPPPPPGLDELETKAEKKVELHGKRKLDIGKDTFVTRKSRKRAKKMTKKAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTSGAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINLPLDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFFNGKALNNAIPGGPKFEPLYPREEEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPVSCIIQNDEEYDTPALFFDPSLNPIPHFIDNNSSLNVSNTKENGDFTLPEDFAPLLAEEEELILPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQLADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWRVWLNFLRGTIPLLERYIGNLITRQFE

Entity 3 Entity 3 polymer

Description description	Pre-mRNA-splicing factor SNU114
Molecular weight formula_weight	114132.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MEGDDLFDEFGNLIGVDPFDSDEEESVLDEQEQYQTNTFEGSGNNNEIESRQLTSLGSKKELGISLEHPYGKEVEVLMETKNTQSPQTPLVEPVTERTKLQEHTIFTQLKKNIPKTRYNRDYMLSMANIPERIINVGVIGPLHSGKTSLMDLLVIDSHKRIPDMSKNVELGWKPLRYLDNLKQEIDRGLSIKLNGSTLLCTDLESKSRMINFLDAPGHVNFMDETAVALAASDLVLIVIDVVEGVTFVVEQLIKQSIKNNVAMCFVINKLDRLILDLKLPPMDAYLKLNHIIANINSFTKGNVFSPIDNNIIFASTKLGFTFTIKEFVSYYYAHSIPSSKIDDFTTRLWGSVYYHKGNFRTKPFENVEKYPTFVEFILIPLYKIFSYALSMEKDKLKNLLRSNFRVNLSQEALQYDPQPFLKHVLQLIFRQQTGLVDAITRCYQPFELFDNKTAHLSIPGKSTPEGTLWAHVLKTVDYGGAEWSLVRIYSGLLKRGDTVRILDTSQSESRQKRQLHDISKTETSNEDEDSKTETPSCEVEEIGLLGGRYVYPVHEAHKGQIVLIKGISSAYIKSATLYSVKSKEDMKQLKFFKPLDYITEAVFKIVLQPLLPRELPKLLDALNKISKYYPGVIIKVEESGEHVILGNGELYMDCLLYDLRASYAKIEIKISDPLTVFSESCSNESFASIPVSNSISRLGEENLPGLSISVAAEPMDSKMIQDLSRNTLGKGQNCLDIDGIMDNPRKLSKILRTEYGWDSLASRNVWSFYNGNVLINDTLPDEISPELLSKYKEQIIQGFYWAVKEGPLAEEPIYGVQYKLLSISVPSDVNIDVMKSQIIPLMKKACYVGLLTAIPILLEPIYEVDITVHAPLLPIVEELMKKRRGSRIYKTIKVAGTPLLEVRGQVPVIESAGFETDLRLSTNGLGMCQLYFWHKIWRKVPGDVLDKDAFIPKLKPAPINSLSRDFVMKTRRRKGISTGGFMSNDGPTLEKYISAELYAQLRENGLVP

Entity 4 Entity 4 polymer

Description description	;U6 snRNA, 5' end ;
Molecular weight formula_weight	9928.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	W

GUUCGCGAAGUAACCCUUCGUGGACAUUUGG

Entity 5 Entity 5 polymer

Description description	Small nuclear ribonucleoprotein-associated protein B
Molecular weight formula_weight	22427.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK

Entity 6 Entity 6 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10385.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD

Entity 7 Entity 7 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9669.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN

Entity 8 Entity 8 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8490.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI

Entity 9 Entity 9 polymer

Description description	Unknown polypeptide
Molecular weight formula_weight	1549.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

XXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	11240.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR

Entity 11 Entity 11 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	16296.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL

Entity 12 Entity 12 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	12876.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MSSQIIDRPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTPVE

Entity 13 Entity 13 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	5gamd00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5game00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5gamf00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5gamg00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5gamh00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5gamj00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.700 Å
Low-resolution limit resolution_low	154.440 Å
R factor r_factor	0.2870
R_work r_work	0.2870
R_free r_free	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	140155

Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor SNU114

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein-associated protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5gam__assembly_1__model_1

5gam__assembly_1__model_1 | I(q)

5gam__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment