5zwo

Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-splicing factor 8

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–2413； UniProt 1–2413

U4/U6 small nuclear ribonucleoprotein PRP4

OrganismNot specified

UniProt P20053

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain K； PDBConstruct 1–465； UniProt 1–465

Pre-mRNA-processing factor 31

OrganismNot specified

UniProt P49704

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain L； PDBConstruct 1–494； UniProt 1–494

Pre-mRNA-splicing factor 6

OrganismNot specified

UniProt P19735

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP6_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain N； PDBConstruct 1–899； UniProt 1–899

U4/U6 small nuclear ribonucleoprotein PRP3

OrganismNot specified

UniProt Q03338

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP3_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain J； PDBConstruct 1–469； UniProt 1–469

Spliceosomal protein DIB1

OrganismNot specified

UniProt Q06819

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DIB1_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–143； UniProt 1–143

13 kDa ribonucleoprotein-associated protein

OrganismNot specified

UniProt P39990

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNU13_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–126； UniProt 1–126

Pre-mRNA-splicing factor SNU114

OrganismNot specified

UniProt P36048

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SN114_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain C； PDBConstruct 1–1008； UniProt 1–1008

U6 snRNA-associated Sm-like protein LSm8

OrganismNot specified

UniProt P47093

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain z； PDBConstruct 1–109； UniProt 1–109

U6 snRNA-associated Sm-like protein LSm2

OrganismNot specified

UniProt P38203

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain q； PDBConstruct 1–95； UniProt 1–95

U6 snRNA-associated Sm-like protein LSm3

OrganismNot specified

UniProt P57743

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain r； PDBConstruct 1–89； UniProt 1–89

U6 snRNA-associated Sm-like protein LSm6

OrganismNot specified

UniProt Q06406

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain x； PDBConstruct 1–86； UniProt 1–86

U6 snRNA-associated Sm-like protein LSm5

OrganismNot specified

UniProt P40089

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain t； PDBConstruct 1–93； UniProt 1–93

U6 snRNA-associated Sm-like protein LSm7

OrganismNot specified

UniProt P53905

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain y； PDBConstruct 1–115； UniProt 1–115

U6 snRNA-associated Sm-like protein LSm4

OrganismNot specified

UniProt P40070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain s； PDBConstruct 1–187； UniProt 1–187

66 kDa U4/U6.U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q12420

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNU66_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain O； PDBConstruct 1–587； UniProt 1–587

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P43321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain S； PDBConstruct 1–101； UniProt 1–101 Author chain d； PDBConstruct 1–101； UniProt 1–101 Author chain l； PDBConstruct 1–101； UniProt 1–101

Small nuclear ribonucleoprotein-associated protein B

OrganismNot specified

UniProt P40018

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain P； PDBConstruct 1–196； UniProt 1–196 Author chain a； PDBConstruct 1–196； UniProt 1–196 Author chain h； PDBConstruct 1–196； UniProt 1–196

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt Q02260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain Q； PDBConstruct 1–146； UniProt 1–146 Author chain b； PDBConstruct 1–146； UniProt 1–146 Author chain m； PDBConstruct 1–146； UniProt 1–146

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt Q06217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain R； PDBConstruct 1–110； UniProt 1–110 Author chain c； PDBConstruct 1–110； UniProt 1–110 Author chain n； PDBConstruct 1–110； UniProt 1–110

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt Q12330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_YEAST
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain T； PDBConstruct 1–94； UniProt 1–94 Author chain e； PDBConstruct 1–94； UniProt 1–94 Author chain i； PDBConstruct 1–94； UniProt 1–94

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P54999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_YEAST
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain U； PDBConstruct 1–86； UniProt 1–86 Author chain f； PDBConstruct 1–86； UniProt 1–86 Author chain j； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P40204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_YEAST
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain V； PDBConstruct 1–77； UniProt 1–77 Author chain g； PDBConstruct 1–77； UniProt 1–77 Author chain k； PDBConstruct 1–77； UniProt 1–77

Pre-mRNA-splicing helicase BRR2

OrganismNot specified

UniProt P32639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BRR2_YEAST
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain D； PDBConstruct 1–2163； UniProt 1–2163

U2 snRNP component HSH155

OrganismNot specified

UniProt P49955

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_YEAST
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 1； PDBConstruct 1–971； UniProt 1–971

Cold sensitive U2 snRNA suppressor 1

OrganismNot specified

UniProt Q02554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CUS1_YEAST
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 2； PDBConstruct 1–436； UniProt 1–436

Pre-mRNA-splicing factor RSE1

OrganismNot specified

UniProt Q04693

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSE1_YEAST
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain 3； PDBConstruct 1–1361； UniProt 1–1361

Protein HSH49

OrganismNot specified

UniProt Q99181

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HSH49_YEAST
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain 4； PDBConstruct 1–213； UniProt 1–213

Pre-mRNA-splicing factor RDS3

OrganismNot specified

UniProt Q06835

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RDS3_YEAST
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain 5； PDBConstruct 1–107； UniProt 1–107

RDS3 complex subunit 10

OrganismNot specified

UniProt P0C074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YSF3_YEAST
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain 6； PDBConstruct 1–85； UniProt 1–85

U2 snRNP component IST3

OrganismNot specified

UniProt P40565

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IST3_YEAST
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain X； PDBConstruct 1–148； UniProt 1–148

Pre-mRNA-splicing factor CWC26

OrganismNot specified

UniProt P46947

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC26_YEAST
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Y； PDBConstruct 1–266； UniProt 1–266

Pre-mRNA leakage protein 1

OrganismNot specified

UniProt Q07930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PML1_YEAST
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain Z； PDBConstruct 1–204； UniProt 1–204

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt Q08963

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_YEAST
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain o； PDBConstruct 1–238； UniProt 1–238

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P40567

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MSL1_YEAST
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain p； PDBConstruct 1–111； UniProt 1–111

Pre-mRNA-splicing factor PRP9

OrganismNot specified

UniProt P19736

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP9_YEAST
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain u； PDBConstruct 1–530； UniProt 1–530

Pre-mRNA-splicing factor PRP21

OrganismNot specified

UniProt P32524

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP21_YEAST
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain w； PDBConstruct 1–280； UniProt 1–280

Pre-mRNA-splicing factor PRP11

OrganismNot specified

UniProt Q07350

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP11_YEAST
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain v； PDBConstruct 1–266； UniProt 1–266

23 kDa U4/U6.U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q12368

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor 38 × 1 （Q00723） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNU23_YEAST
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain W； PDBConstruct 1–194； UniProt 1–194

Pre-mRNA-splicing factor 38

OrganismNot specified

UniProt Q00723

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor SPP381 × 1 （P38282） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP38_YEAST
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain 0； PDBConstruct 1–242； UniProt 1–242

Pre-mRNA-splicing factor SPP381

OrganismNot specified

UniProt P38282

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 55 RNA 5	Pre-mRNA-splicing factor 8 × 1 （P33334） U4/U6 small nuclear ribonucleoprotein PRP4 × 1 （P20053） Pre-mRNA-processing factor 31 × 1 （P49704） Pre-mRNA-splicing factor 6 × 1 （P19735） U4/U6 small nuclear ribonucleoprotein PRP3 × 1 （Q03338） Spliceosomal protein DIB1 × 1 （Q06819） 13 kDa ribonucleoprotein-associated protein × 1 （P39990） Pre-mRNA-splicing factor SNU114 × 1 （P36048） U6 snRNA-associated Sm-like protein LSm8 × 1 （P47093） U6 snRNA-associated Sm-like protein LSm2 × 1 （P38203） U6 snRNA-associated Sm-like protein LSm3 × 1 （P57743） U6 snRNA-associated Sm-like protein LSm6 × 1 （Q06406） U6 snRNA-associated Sm-like protein LSm5 × 1 （P40089） U6 snRNA-associated Sm-like protein LSm7 × 1 （P53905） U6 snRNA-associated Sm-like protein LSm4 × 1 （P40070） U6 snRNA × 1 U5 snRNA × 1 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12420） Small nuclear ribonucleoprotein Sm D3 × 3 （P43321） Small nuclear ribonucleoprotein-associated protein B × 3 （P40018） Small nuclear ribonucleoprotein Sm D1 × 3 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 3 （Q06217） Small nuclear ribonucleoprotein E × 3 （Q12330） Small nuclear ribonucleoprotein F × 3 （P54999） Small nuclear ribonucleoprotein G × 3 （P40204） U4 snRNA × 1 Pre-mRNA-splicing helicase BRR2 × 1 （P32639） Pre-mRNA × 1 U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） RDS3 complex subunit 10 × 1 （P0C074） U2 snRNP component IST3 × 1 （P40565） Pre-mRNA-splicing factor CWC26 × 1 （P46947） Pre-mRNA leakage protein 1 × 1 （Q07930） U2 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP11 × 1 （Q07350） 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component × 1 （Q12368） Pre-mRNA-splicing factor 38 × 1 （Q00723） GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SP381_YEAST
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain 9； PDBConstruct 1–291； UniProt 1–291

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5zwo
Deposition date deposition_date	2018-05-16
Structure title title	Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom
Keywords keywords	spliceosome, assembly, B complex, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5zwo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5zwo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5zwo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	102.50 Å
Total Rg	102.10 Å
Atom count	91259
Residues	13774
Excluded volume	1502300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5zwo__assembly_1__model_1`	60-meric （60）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (48)

Entity 1 Entity 1 polymer

Description description	Pre-mRNA-splicing factor 8
Molecular weight formula_weight	279867.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	91261

MSGLPPPPPGFEEDSDLALPPPPPPPPGYEIEELDNPMVPSSVNEDTFLPPPPPPPSNFEINAEEIVDFTLPPPPPPPGLDELETKAEKKVELHGKRKLDIGKDTFVTRKSRKRAKKMTKKAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTSGAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINLPLDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFFNGKALNNAIPGGPKFEPLYPREEEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPVSCIIQNDEEYDTPALFFDPSLNPIPHFIDNNSSLNVSNTKENGDFTLPEDFAPLLAEEEELILPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQLADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWRVWLNFLRGTIPLLERYIGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESIRQKKARTILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHVEKTMVKKNLGRLTRLWIKNEQERQRQIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPFPPLTYKNDTKILVLALEDLKDVYASKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDITMMENYQNISPVYSVDPLEKITDAYLDQYLWYEADQRKLFPNWIKPSDSEIPPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTLGEMAEKIDFTLLNRLLRLIVDPNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDLAGPANNPNEFMQFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPNFENSIGYNNRKCWPKDSRMRLIRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLFSMCGFEVRILPRQRMEEVVSNDEGVWDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGILMASGSTTFTKVAAKWNTSLISLFTYFREAIVATEPLLDILVKGETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRVWAEYATKRQEAIQQNRRLAFEELEGSWDRGIPRISTLFQRDRHTLAYDRGHRIRREFKQYSLERNSPFWWTNSHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFNSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGELDVLQIESVTKETVHPRKSYKMNSSAADITMESVHEWEVSKPSLLHETNDSFKGLITNKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFNGLKPLIQNSMRTIMKANPALYVLRERIRKGLQIYQSSVQEPFLNSSNYAELFNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPTELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNEESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILTEYGRKYNVNISALTQTEIKDIILGQNIKAPSVKRQKMAELEAARSEKQNDEEAAGASTVMKTKTINAQGEEIVVVASADYESQTFSSKNEWRKSAIANTLLYLRLKNIYVSADDFVEEQNVYVLPKNLLKKFIEISDVKIQVAAFIYGMSAKDHPKVKEIKTVVLVPQLGHVGSVQISNIPDIGDLPDTEGLELLGWIHTQTEELKFMAASEVATHSKLFADKKRDCIDISIFSTPGSVSLSAYNLTDEGYQWGEENKDIMNVLSEGFEPTFSTHAQLLLSDRITGNFIIPSGNVWNYTFMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQFSELAGDEELEAEQIDVFS

Entity 2 Entity 2 polymer

Description description	U4/U6 small nuclear ribonucleoprotein PRP4
Molecular weight formula_weight	52507.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSKYIALENLPVDLQHKGATQNESTADILKQLPHERLQAVLEKIPEEDLEVRRLLSILKKPEVVENEDVQQRRIRLAEILMVDEIDLENINNMENINGEEVDEEDDEDFFTPATSELIFARRFLINYSLERSRKRLQKEMERHQKFNTRQELLSRRTELQRMANLELAGSQLVSTKPISAVSLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN

Entity 3 Entity 3 polymer

Description description	Pre-mRNA-processing factor 31
Molecular weight formula_weight	56382.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSSEEDYFDELEYDLADEVNEEKEDIQTKKLTTVNCQTEKFNPFEILPESIELFRTLALISPDRLSLSETAQILPKIVDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRISEANQQADEFLISLGHNTEQPNLSPEMVQMHKKQHTNPEEETNWFSGHG

Entity 4 Entity 4 polymer

Description description	Pre-mRNA-splicing factor 6
Molecular weight formula_weight	104370.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MERPSFLDQEPPAGYVPGIGRGATGFSTKEKQVVSNDDKGRRIPKRYRENLNNHLQSQPKDDEDDEAANVFKTLELKLAQKKKKRANEKDDDNSVDSSNVKRQFADLKESLAAVTESEWMDIPDATDFTRRNKRNRIQEQLNRKTYAAPDSLIPGNVDLNKLTEEREKLLQSQIDENLAQLTKNASNPIQVNKPNAATDALSYLKDLENDRVNSLSDATLEDLQKMRTILKSYRKADPTNPQGWIASARLEEKARKFSVAKKIIENGCQECPRSSDIWLENIRLHESDVHYCKTLVATAINFNPTSPLLWFKAIDLESTTVNKYRVVRKALQEIPRDEGLWKLAVSFEADKAQVIKMLEKATQFIPQSMDLLTAYTNLQSYHNAKMTLNSFRKILPQEPEIWIISTLLEERNNPDIPVDKLVSLLKEGLLELSKNGYKATLSAWLKRAEALNDAPNSNLTCQAIVYAILEWLRESGEYESELNNVDQILEKMPHSKVQIAVLKKLIQWDPCDTVLWSRLKMATESYHKIEELLAFFQELLFQTKNSDDIRANMREKSPGLLMMYVSEYWKAQKGDTRQTLVLIDQIIDFAPHNLDLRFFKIKLLGRSLQLDELRDFFQQTFSSLEDFKISGTERLYYKYVNFLRYQDLNEEAIKFLNERCLKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLVPNCPLLWVSLSKIDEIDLKNPVRARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPSNALLWVEQIKLFKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAEAQYETSLKWLERALKKCSRYGDTWVWLFRTYARLGKDTVDLYNMFDQCEPTYGPEWIAASKNVKMQYCTPREILLRLMNDK

Entity 5 Entity 5 polymer

Description description	U4/U6 small nuclear ribonucleoprotein PRP3
Molecular weight formula_weight	55974.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPPRNTYEKGNPKRQNSPYYKPSFLRREETTNDEEKFQGHGLKTELHSALKSSNLNLIRRTYQTGENPYLSDPHDRGSSSRFNRRYERGLKFYQKGEISKRIAQERTLQKQQEEEELKRKLKQEEDEKDKRKLIESGDLPNLELHEDKFLLDLSKFKIYYDNNHGYEWWDTAYLDEKGELMEKYDMNGTSPAEEKLAEDIDEVDDDDDDEHPSIRYVAHPLPEKINEAKVSIKAYLTQHERKRLRRNRRKMAREAREIKIKLGLLPKPEPKVKLSNMMSVFENDQNITDPTAWEKVVKDQVDLRKRKHLEENERRHEDAIKRRKEAVNMNVEKPTVYHCKVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEKSCKFYENLVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQDSLLRTLGQFDSEHFYSPVQT

Entity 6 Entity 6 polymer

Description description	Spliceosomal protein DIB1
Molecular weight formula_weight	16798.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKRVS

Entity 7 Entity 7 polymer

Description description	13 kDa ribonucleoprotein-associated protein
Molecular weight formula_weight	13582.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI

Entity 8 Entity 8 polymer

Description description	Pre-mRNA-splicing factor SNU114
Molecular weight formula_weight	114174.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MEGDDLFDEFGNLIGVDPFDSDEEESVLDEQEQYQTNTFEGSGNNNEIESRQLTSLGSKKELGISLEHPYGKEVEVLMETKNTQSPQTPLVEPVTERTKLQEHTIFTQLKKNIPKTRYNRDYMLSMANIPERIINVGVIGPLHSGKTSLMDLLVIDSHKRIPDMSKNVELGWKPLRYLDNLKQEIDRGLSIKLNGSTLLCTDLESKSRMINFLDAPGHVNFMDETAVALAASDLVLIVIDVVEGVTFVVEQLIKQSIKNNVAMCFVINKLDRLILDLKLPPMDAYLKLNHIIANINSFTKGNVFSPIDNNIIFASTKLGFTFTIKEFVSYYYAHSIPSSKIDDFTTRLWGSVYYHKGNFRTKPFENVEKYPTFVEFILIPLYKIFSYALSMEKDKLKNLLRSNFRVNLSQEALQYDPQPFLKHVLQLIFRQQTGLVDAITRCYQPFELFDNKTAHLSIPGKSTPEGTLWAHVLKTVDYGGAEWSLVRIYSGLLKRGDTVRILDTSQSESRQKRQLHDISKTETSNEDEDEDDETPSCEVEEIGLLGGRYVYPVHEAHKGQIVLIKGISSAYIKSATLYSVKSKEDMKQLKFFKPLDYITEAVFKIVLQPLLPRELPKLLDALNKISKYYPGVIIKVEESGEHVILGNGELYMDCLLYDLRASYAKIEIKISDPLTVFSESCSNESFASIPVSNSISRLGEENLPGLSISVAAEPMDSKMIQDLSRNTLGKGQNCLDIDGIMDNPRKLSKILRTEYGWDSLASRNVWSFYNGNVLINDTLPDEISPELLSKYKEQIIQGFYWAVKEGPLAEEPIYGVQYKLLSISVPSDVNIDVMKSQIIPLMKKACYVGLLTAIPILLEPIYEVDITVHAPLLPIVEELMKKRRGSRIYKTIKVAGTPLLEVRGQVPVIESAGFETDLRLSTNGLGMCQLYFWHKIWRKVPGDVLDKDAFIPKLKPAPINSLSRDFVMKTRRRKGISTGGFMSNDGPTLEKYISAELYAQLRENGLVP

Entity 9 Entity 9 polymer

Description description	U6 snRNA-associated Sm-like protein LSm8
Molecular weight formula_weight	12403.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLIDAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKVYESKTK

Entity 10 Entity 10 polymer

Description description	U6 snRNA-associated Sm-like protein LSm2
Molecular weight formula_weight	11177.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK

Entity 11 Entity 11 polymer

Description description	U6 snRNA-associated Sm-like protein LSm3
Molecular weight formula_weight	10039.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPSEDDDGAVEI

Entity 12 Entity 12 polymer

Description description	U6 snRNA-associated Sm-like protein LSm6
Molecular weight formula_weight	9406.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MSGKASTEGSVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI

Entity 13 Entity 13 polymer

Description description	U6 snRNA-associated Sm-like protein LSm5
Molecular weight formula_weight	10433.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MSLPEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKKTPTEAL

Entity 14 Entity 14 polymer

Description description	U6 snRNA-associated Sm-like protein LSm7
Molecular weight formula_weight	13027.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MHQQHSKSENKPQQQRKKFEGPKREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNPDDENNTELISKNARKLGLTVIRGTILVSLSSAEGSDVLYMQK

Entity 15 Entity 15 polymer

Description description	U6 snRNA-associated Sm-like protein LSm4
Molecular weight formula_weight	21298.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQINSNNNSNSNGPGHKRYYNNRDSNNNRGNYNRRNNNNGNSNRRPYSQNRQYNNSNSSNINNSINSINSNNQNMNNGLGGSVQHHFNSSSPQKVEF

Entity 16 Entity 16 polymer

Description description	U6 snRNA
Molecular weight formula_weight	35846.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	F

GUUCGCGAAAUUUUACUUCGUGGACAUUUGGUCAAUUUGAAACAAUACAGAGAUGAUCAGCAGUUCCCCUGCAUAAGGAUGAACCGUUUUACAAAGAGAUUUAUUUCGUUUU

Entity 17 Entity 17 polymer

Description description	U5 snRNA
Molecular weight formula_weight	68643.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

AAGCAGCUUUACAGAUCAAUGGCGGAGGGAGGUCAACAUCAAGAACUGUGGGCCUUUUAUUGCCUAUAGAACUUAUAACGAACAUGGUUCUUGCCUUUUACCAGAACCAUCCGGGUGUUGUCUCCAUAGAAACAGGUAAAGCUGUCCGUUACUGUGGGCUUGCCAUAUUUUUUGGAACUUUUCUGCCCUUUUUCUCAAUGAGUAAGGAGGGCGU

Entity 18 Entity 18 polymer

Description description	66 kDa U4/U6.U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	66544.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MNKTENLSIEETNEIREKLGMKPIPVFQEKNTDHKESLSIEETNELRASLGLKLIPPQQNFNSSPPNVHNTSKIDELREKITKFQKKANAPLRMAHLLEETNVNDDSSWLENMDAIPSSHESKRSSTLPRKGATKEDENIDLHNVQVSYNIEALSPKKDTILTLKESSIFDDTDSTEVLENVKAAEENADREKLRLRQMNKDRRQKKKILNVSSLDIEEEEEGEKHSITTTHLIIGAEQGVMKAPNTISAKPPTGKVKVNFDSANNMSDEDGGDFKPLKIKKRKIKDPRSTKARKSKITDKMEIVKLVDEDESLSWMEEEQPVTIINPRTSSNNELKGPEDLAREIEKARDEEKRRTESILKMREISNSIVVDEKVTFLNTLDTSLSERSATENKVKVHGEGEKNIGDVTNGHTKEGSGNNTLTEAVNNEPNYEGDAENAPNFFSGLASTLGYLRKKSVFTTGDVDLKPGKDVNNSESLRRDVRNKEHTGTGTYTKDKLHGLEQFTSSDSSNANTHSKRQDHYDPDIKLVYRDEKGNRLTTKEAYKKLSQKFHGTKSNKKKRAKMKSRIEARKNTPENGSLFEFDDN

Entity 19 Entity 19 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	11240.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,S,l

MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR

Entity 20 Entity 20 polymer

Description description	Small nuclear ribonucleoprotein-associated protein B
Molecular weight formula_weight	22427.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,P,h

MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK

Entity 21 Entity 21 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	16296.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,Q,m

MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL

Entity 22 Entity 22 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	12876.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,R,n

MSSQIIDRPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTPVE

Entity 23 Entity 23 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10385.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,T,i

MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD

Entity 24 Entity 24 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9669.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,U,j

MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN

Entity 25 Entity 25 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8490.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,V,k

MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI

Entity 26 Entity 26 polymer

Description description	U4 snRNA
Molecular weight formula_weight	51492.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	I

AUCCUUAUGCACGGGAAAUACGCAUAUCAGUGAGGAUUCGUCCGAGAUUGUGUUUUUGCUGGUUGAAAUUUAAUUAUAAACCAGACCGUCUCCUCAUGGUCAAUUCGGUGUUCGCUUUUGAAUACUUCAAGACUAUGUAGGGAAUUUUUGGAAUUACCUUU

Entity 27 Entity 27 polymer

Description description	Pre-mRNA-splicing helicase BRR2
Molecular weight formula_weight	246470.3 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTEHETKDKAKKIREIYRYDEMSNKVLKVDKRFMNTSQNPQRDAEISQPKSMSGRISAKDMGQGLCNNINKGLKENDVAVEKTGKSASLKKIQQHNTILNSSSDFRLHYYPKDPSNVETYEQILQWVTEVLGNDIPHDLIIGTADIFIRQLKENEENEDGNIEERKEKIQHELGINIDSLKFNELVKLMKNITDYETHPDNSNKQAVAILADDEKSDEEEVTEMSNNANVLGGEINDNEDDDEEYDYNDVEVNSKKKNKRALPNIENDIIKLSDSKTSNIESVPIYSIDEFFLQRKLRSELGYKDTSVIQDLSEKILNDIETLEHNPVALEQKLVDLLKFENISLAEFILKNRSTIFWGIRLAKSTENEIPNLIEKMVAKGLNDLVEQYKFRETTHSKRELDSGDDQPQSSEAKRTKFSNPAIPPVIDLEKIKFDESSKLMTVTKVSLPEGSFKRVKPQYDEIHIPAPSKPVIDYELKEITSLPDWCQEAFPSSETTSLNPIQSKVFHAAFEGDSNMLICAPTGSGKTNIALLTVLKALSHHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSRKQIDETQVLVSTPEKWDITTRNSNNLAIVELVRLLIIDEIHLLHDDRGPVLESIVARTFWASKYGQEYPRIIGLSATLPNYEDVGRFLRVPKEGLFYFDSSFRPCPLSQQFCGIKERNSLKKLKAMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLKNKFAEENITHKLTKNDAGSKQILKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPRYDTFGEGIIITDQSNVQYYLSVLNQQLPIESQFVSKLVDNLNAEVVAGNIKCRNDAVNWLAYTYLYVRMLASPMLYKVPDISSDGQLKKFRESLVHSALCILKEQELVLYDAENDVIEATDLGNIASSFYINHASMDVYNRELDEHTTQIDLFRIFSMSEEFKYVSVRYEEKRELKQLLEKAPIPIREDIDDPLAKVNVLLQSYFSQLKFEGFALNSDIVFIHQNAGRLLRAMFEICLKRGWGHPTRMLLNLCKSATTKMWPTNCPLRQFKTCPVEVIKRLEASTVPWGDYLQLETPAEVGRAIRSEKYGKQVYDLLKRFPKMSVTCNAQPITRSVMRFNIEIIADWIWDMNVHGSLEPFLLMLEDTDGDSILYYDVLFITPDIVGHEFTLSFTYELKQHNQNNLPPNFFLTLISENWWHSEFEIPVSFNGFKLPKKFPPPTPLLENISISTSELGNDDFSEVFEFKTFNKIQSQVFESLYNSNDSVFVGSGKGTGKTAMAELALLNHWRQNKGRAVYINPSGEKIDFLLSDWNKRFSHLAGGKIINKLGNDPSLNLKLLAKSHVLLATPVQFELLSRRWRQRKNIQSLELMIYDDAHEISQGVYGAVYETLISRMIFIATQLEKKIRFVCLSNCLANARDFGEWAGMTKSNIYNFSPSERIEPLEINIQSFKDVEHISFNFSMLQMAFEASAAAAGNRNSSSVFLPSRKDCMEVASAFMKFSKAIEWDMLNVEEEQIVPYIEKLTDGHLRAPLKHGVGILYKGMASNDERIVKRLYEYGAVSVLLISKDCSAFACKTDEVIILGTNLYDGAEHKYMPYTINELLEMVGLASGNDSMAGKVLILTSHNMKAYYKKFLIEPLPTESYLQYIIHDTLNNEIANSIIQSKQDCVDWFTYSYFYRRIHVNPSYYGVRDTSPHGISVFLSNLVETCLNDLVESSFIEIDDTEAEVTAEVNGGDDEATEIISTLSNGLIASHYGVSFFTIQSFVSSLSNTSTLKNMLYVLSTAVEFESVPLRKGDRALLVKLSKRLPLRFPEHTSSGSVSFKVFLLLQAYFSRLELPVDFQNDLKDILEKVVPLINVVVDILSANGYLNATTAMDLAQMLIQGVWDVDNPLRQIPHFNNKILEKCKEINVETVYDIMALEDEERDEILTLTDSQLAQVAAFVNNYPNVELTYSLNNSDSLISGVKQKITIQLTRDVEPENLQVTSEKYPFDKLESWWLVLGEVSKKELYAIKKVTLNKETQQYELEFDTPTSGKHNLTIWCVCDSYLDADKELSFEINVK

Entity 28 Entity 28 polymer

Description description	Pre-mRNA
Molecular weight formula_weight	19067.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	G

AAAAAAAAUUUUUUUUAAAAAAAAAAAACUAGAUACUAACACAUUUAAUUUUUUUUUGUU

Entity 29 Entity 29 polymer

Description description	U2 snRNP component HSH155
Molecular weight formula_weight	110166.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MSHPIQFVNANNSDKSHQLGGQYSIPQDLRENLQKEAARIGENEKDVLQEKMETRTVQNREDSYHKRRFDMKFEPDSDTQTVTSSENTQDAVVPRKRKSRWDVKGYEPPDESSTAVKENSDSALVNVEGIHDLMFFKPSDHKYFADVISKKPIDELNKDEKKERTLSMLLLKIKNGNTASRRTSMRILTDKAVTFGPEMIFNRLLPILLDRSLEDQERHLMIKTIDRVLYQLGDLTKPYVHKILVVAAPLLIDEDPMVRSTGQEIITNLSTVAGLKTILTVMRPDIENEDEYVRNVTSRAAAVVAKALGVNQLLPFINAACHSRKSWKARHTGIKIVQQIGILLGIGVLNHLTGLMSCIKDCLMDDHVPVRIVTAHTLSTLAENSYPYGIEVFNVVLEPLWKGIRSHRGKVLSSFLKAVGSMIPLMDPEYAGYYTTEAMRIIRREFDSPDDEMKKTILLVLQKCSAVESITPKFLREEIAPEFFQKFWVRRVALDRPLNKVVTYTTVTLAKKLGCSYTIDKLLTPLRDEAEPFRTMAVHAVTRTVNLLGTADLDERLETRLIDALLIAFQEQTNSDSIIFKGFGAVTVSLDIRMKPFLAPIVSTILNHLKHKTPLVRQHAADLCAILIPVIKNCHEFEMLNKLNIILYESLGEVYPEVLGSIINAMYCITSVMDLDKLQPPINQILPTLTPILRNKHRKVEVNTIKFVGLIGKLAPTYAPPKEWMRICFELLELLKSTNKEIRRSANATFGFIAEAIGPHDVLVALLNNLKVQERQLRVCTAVAIGIVAKVCGPYNVLPVIMNEYTTPETNVQNGVLKAMSFMFEYIGNMSKDYIYFITPLLEDALTDRDLVHRQTASNVITHLALNCSGTGHEDAFIHLMNLLIPNIFETSPHAIMRILEGLEALSQALGPGLFMNYIWAGLFHPAKNVRKAFWRVYNNMYVMYQDAMVPFYPVTPDNNEEYIEELDLVL

Entity 30 Entity 30 polymer

Description description	Cold sensitive U2 snRNA suppressor 1
Molecular weight formula_weight	50339.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MARTKSRKRSGNNQNKNASVVNNKAEIAAMIDARRLEQKKKGGVTNSKGKTNKVVDAKLEKEFKDVLQRFQVQENDTPKEITKDEKNNHVVIVEKNPVMNRKHTAEDELEDTPSDGIEEHLSARKRRKTEKPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPQSGLDGQDEKSLKEASRARVQPKMGALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQELRAIMNLPEGQLPPWCMKMKDIGLPTGYPDLKIAGLNWDITNLKGDVYGKIIPNHHSRSKKQGRNYFGALISFETPEFENSKEDTQANAENGRQDDKIDDEVEHKLDHFQEDISEVTSAEEKLERNEEESEKQLYTVLK

Entity 31 Entity 31 polymer

Description description	Pre-mRNA-splicing factor RSE1
Molecular weight formula_weight	153956.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MWGGGKMAVVSLSPHTAKMRKLFGQASTTMAYDGLKREAERRTRSDHNITMVAKDDELYLYHLTLKKQTNFVHSCIGHFVDLEAGSKREQSQLCVATETHLELYDTADGELKLIAKFQNLFATITSMKSLDLPHSGSRAKASNWPTFLALTSDSGNLSIVQIIMHAGALRLKTLVNQPLTRTTLRRVSPISYMEIDPNGRCIILSSVEQNKLCFLVDYAQKLRISSPLEIIRPHMVTLDMAVVDVNFNNPCFVTLEIDNAATQLSVHLIFYVLELGLNHIVKKADYLVNPSANFVLSLPDLSRYNITTSLSDNNYDADYDTLFNPFVVIGFENHILVKDMNGFFSLKVEIPKRSITNSRHKNVTIISGIVQKLKNDFFVLLQSNHGDLFKLTVSPDTNDRNRPLVQLSYFDTIQNSHQLHIFKNGYLFALSEMNNNFLFQFEKLGVEKNDFSNVLTSKDPNKSLVFEPSIKLQNLSILSQQLNLNPSIKSQIVSDSPLSIATKHFTNNKIITLTNAVNYSNLISTSLPPNATKLWLIPDPATTGDNNTLLFITFPKKTMILQIDNESMEELTPDEATRSAFKLSQDTTIHTCLMGSHSIIQVCTAELRHIVPTGKSRYSNKLTWVPPAGIRIVCATSSKTQLIISLSNYELVYFKIDVSSDSLIELTTHPELDTMPSKVAIVQDTQHADLLAIADNEGMIKIMSLKDQKEDFLTVISLQLVSEKISDMIMVRDSSIGQLNLHVGLENGVYMKFHIGDVDGSFTDIKRRFLGLKPVSLSYLREISVSLNNEEEEEEEEDDDDEKEEEEINSSGAKWMSCVVCHSSSTWVSYTWKNVWTIRQLKDQNMLSCSKFVNADVAINGVCSISSSGRLNIGRVSNFPTLDNWFHVHESSVNKQENGGGDESNEEEEDEMEEEMEMLQISTFRPRTILSFPNNPKSILFIDNHSGKKQCRISLQIDGECLKFGSSDHLYKILDDIDCVSAAIIDFTRQADHLIICAGDKRLLTYKILVNKDKLSFDIELLHQTEIISPIHAMLKFKNFLLTAMGSTIVLYGLGKKQLLRRSVTQTPVSITKIVSMHQWNYERLAVGDIHESVTLFIWDPAGNVFIPYVDDSVKRHVTVLKFLDEATVIGADRYGNAWTLRSPPECEKIMSNHDPSELSNGAIKYPLDVITLQQKLPNTYDCKFKFQLLNHFFVNDIITDFHILDSLSNSDRPGCIYMGLQGTVGCFIPLLSKGNVFMMGNIENIMAEADDTFYLDYESRKKNNNMRKEDDEEESGSVVLQGRHGIEDEIICEGSCSILGRDHQEYRSYYAPVRKVIDGDLCENFLRLSLNEQEFLAKNLKSVQVEDIIQTINEVRTNYM

Entity 32 Entity 32 polymer

Description description	Protein HSH49
Molecular weight formula_weight	24534.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MNYSADSGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGKLIREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFKENGKGNAKYGDDVDRLLNKEALKHNMLK

Entity 33 Entity 33 polymer

Description description	Pre-mRNA-splicing factor RDS3
Molecular weight formula_weight	12283.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MSRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKKKV

Entity 34 Entity 34 polymer

Description description	RDS3 complex subunit 10
Molecular weight formula_weight	10045.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAEKQRQLKLQKIYKQKYIGLGDESTTREQWQRNVRNDTLNTLQGHSASLEYVSLSRGDLSIRDTRIHLLKSMSPGYKAYLREER

Entity 35 Entity 35 polymer

Description description	U2 snRNP component IST3
Molecular weight formula_weight	17121.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MNKIQQINDKELQSGILSPHQSWHNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYEAVKEELDRDIVSKNNAEKLILAKKDQPN

Entity 36 Entity 36 polymer

Description description	Pre-mRNA-splicing factor CWC26
Molecular weight formula_weight	30529.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MALHQYLSETYGPTKPKNKTKKKKKESKSDANSDKTSLIVKERLSTLQQEQEKSGVASFSKFDKQKSKNIWKNLETNELSHAITHPSASSITGNESKNDLKEIRAQEPLVTVADKSKTRKTIYRDAQGHKIQEDSKIDDSSFSRSKYEDEKAAEREQYLKNLNMGDVQKLGINVDAHDKKKNQTASSLTIEDPAITFTHDKERTVKTSLLGRKLYDKPAPENRFAIMPGSRWDGVHRSNGFEEKWFAKQNEINEKKVQSYTLQEDY

Entity 37 Entity 37 polymer

Description description	Pre-mRNA leakage protein 1
Molecular weight formula_weight	23685.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MFHRRKRPYNTRNYGHDDKKFKSQYIDIMPDFSPSGLLELESNNKEGIALKHVEPQDAISPDNYMDMLGLEARDRTMYELVIYRKNDKDKGPWKRYDLNGRSCYLVGRELGHSLDTDLDDRTEIVVADIGIPEETSSKQHCVIQFRNVRGILKCYVMDLDSSNGTCLNNVVIPGARYIELRSGDVLTLSEFEEDNDYELIFMNV

Entity 38 Entity 38 polymer

Description description	U2 snRNA
Molecular weight formula_weight	376324.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	H

ACGAAUCUCUUUGCCUUUUGGCUUAGAUCAAGUGUAGUAUCUGUUCUUUUCAGUGUAACAACUGAAAUGACCUCAAUGAGGCUCAUUACCUUUUAAUUUGUUACAAUACACAUUUUUUGGCACCCAAAAUAAUAAAAUGGACGGGAAGAGACUUUUUAAGCAAGACGUUUUCCGCUAAUGACACCUCGCACGAGUCGUUCUUGCUAUCUUUGGUCGCUUGAUGUUUCUUCUUAACCCGUUCUUAUGAUGGUUUUUCGAAAUUGGUUUUUGAGACGACGGUUGCUCAAGGUUAUUGUUUUUGUUUUCUUCUGGUUGUUUUCUAUUUUCUUUUUUUUAGCUUUCUGUUUCUCCCUUAGUUUGGCUUUUUGCUUCAUACUCUUCCCUGUCUUUCCGAGCCGUUUAUGUCCAACGCGGGAUUUGGUUUUUCUUUAUCGAUGGGAAGAAAUGGUGCUAUAGUAGGUUGGGAGAUAAUAUUUAUGGUAUGGGGUGCUAGUGCGGAUGGGGCGCUCUUAUUGUUGAUUUCUUCGCUCGUCUUCUUUUUCUGGUGGCGCUGCAAGAGGAAGUUUUUCGACUUUGUUAUGAUUUUUGGUUUGCAAGGAAAGGUGUCUUACGAUUCUUUUUUUGAUGUAAUAGGAUAAGCUUGCUUAUCCCCCAAGUAUCGGCCAAAGUUGUUGAUUUUCCUUUUGAAGUGUCCUCGGUUUGAGGGGGUGUAGGGUGGGGUUGGUCUACAAUAAGAGUGUUCCAUUGUUAACGUGCUGGCGUCUUUUACUAUAUUUUUUUUCCCAGUUUAUUUUGUGCUUAUUUUCUCAUUGAGGAGAAGGAGCUCUUCUCGCAGGAUAUAAAUGGAGGUUUGCUAAAGGGGAGGAGAUGUGUUUGUGAGAAUACUGCUGAGAGAGUUCUGGAAGAGAAAAAAAGGAGGCAAUGGAAGGCGUUUGCUGGGAAAAGAGAAGAGCCAUGACUGCAUCUGUUGUUUCAAGGCCAGUUUUAUUAACCGCCUAUGUCAUAGAGGCGUUUUUUUUGGAGGGAUUUGAAGAAUGCCGGCGGCAUCAAGAAACGGACUUGAUGGUUGACGCCUGUUUUUAAAGUUAGAGACGUCGCGACCCUCGCACUUGUGGAGUCGUUCUUGACUUUUACUUUGGUCGCUUGAUGUUUCUCUCGUCUUCCCGUUCGCUCUU

Entity 39 Entity 39 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	27232.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MKFTPSIVIDAPQYYVDHFNGKYNVDKCVILRDLQLETDSESMPSSLKHLTKPTHILDLTNNDLIMIPDLSRRDDIHTLLLGRNNIVEVDGRLLPMNVQNLTLSNNSIRRFEDLQRLRRAPRTLKNLTLIGNQVCHLANYREHVLRLVPHLETLDFQNVTAEERKSAMSFPRQADGDTLGPVNTAIRDNGSRDKTMEIMNLVVSKMTVERRNELKKQLAEATSLEEIARLEKLLSGGV

Entity 40 Entity 40 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	12850.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MVEPARKKQRIDRDTHHTVAEPVTEAKNTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL

Entity 41 Entity 41 polymer

Description description	Pre-mRNA-splicing factor PRP9
Molecular weight formula_weight	63126.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIYKFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLEKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV

Entity 42 Entity 42 polymer

Description description	Pre-mRNA-splicing factor PRP21
Molecular weight formula_weight	33111.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MEPEDTQLKEDIKTTVNYIKQHGVEFENKLLEDERFSFIKKDDPLHEYYTKLMNEPTDTVSGEDNDRKSEREIARPPDFLFSQYDTGISRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFSIPEDTEIFEGSLDLEQMRLRRVQTGIKLFDSIKPTNEEEKIVSDQGKQKGGDSKGKKRKIRAVGETRLKKSKK

Entity 43 Entity 43 polymer

Description description	Pre-mRNA-splicing factor PRP11
Molecular weight formula_weight	29962.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQDEKDDQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKSSLGREGQTTHDFRQQQKIIEAKQSLKNNGTIPVCKIATVKNPKNGSVGLAIQVNYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFENIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQAEQEQADV

Entity 44 Entity 44 polymer

Description description	23 kDa U4/U6.U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	22717.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MSNFGRRTWDREEYAEQARSGYDDRSLKATLTPIELQALKSKYTNYDHLIKGSLKDLNKRKLTANTESLSSFKRGKKFGFYCDICNLTFKDTLQYIDHLNHKVHAIKFENLFDEPLIIDIRDNDDVPQEEFELCYHNLIKDFVEVRSMETQSKRKRLLDTDVEKAKKVATKPSIESESKVSQMMGFSNFATSKK

Entity 45 Entity 45 polymer

Description description	Pre-mRNA-splicing factor 38
Molecular weight formula_weight	27995.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MAVNEFQVESNISPKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLSNESLRGNTMVELLKVMIGAFGTIKGQNGHLHMMVLGGIEFKCILMKLIEIRPNFQQLNFLLNVKNENGFDSKYIIALLLVYARLQYYYLNGNNKNDDDENDLIKLFKVQLYKYSQHYFKLKSFPLQVDCFAHSYNEELCIIHIDELVDWLATQDHIWGIPLGKCQWNKIYNSDEESSSSESESNGDSEDDNDTSSES

Entity 46 Entity 46 polymer

Description description	Pre-mRNA-splicing factor SPP381
Molecular weight formula_weight	33830.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MSFRHFKRRLDTSSADESSSADEEHPDQNVSLTEKSASLSHSDLGGEILNGTGKNRTPNDGQESNESDGSPESDESPESEESSDNSDSSDSDDMRPLPRPLFMKKKANNLQKATKIDQPWNAQDDARVLQTKKENMIKNIDKANQVAKNYETMKLRLNTNYSTNEELIKQCLLLDDNDEVDSEKERQKWFERQNERKQKHRRIQLAKQRESEEYEAKRFEAMQKGKDGNTKYDVILDKEKEKLDHKKQRSAEKVEKSHNNNRYKITRTKNVEFGDLGKNSRDYEETEYSVI

Entity 47 Entity 47 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 48 Entity 48 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 27 domains

CATH v4.4 (27 domains)

Domain ID domain_id	5zwoE00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	5zwoM00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/S12

Domain ID domain_id	5zwoR00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoS00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoT00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoU00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoV00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoc00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwod00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoe00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwof00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwog00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoi00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoj00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwok00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwol00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwon00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwop00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	5zwoq00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwor00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwos00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwot00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwow01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	790 — Surp module

Domain ID domain_id	5zwow02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1320 —

Domain ID domain_id	5zwox00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoy00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5zwoz00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

▶

Resolution resolution	3.900 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	342588

Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein PRP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing factor 31

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein PRP3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spliceosomal protein DIB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

13 kDa ribonucleoprotein-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor SNU114

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer