7oqb

The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U2 snRNP component HSH155

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain O； PDBConstruct 1–971； UniProt 1–971

Pre-mRNA-splicing factor PRP11

OrganismNot specified

UniProt Q07350

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP11_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain U； PDBConstruct 1–282； UniProt 1–266

Pre-mRNA-splicing factor PRP21

OrganismNot specified

UniProt P32524

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP21_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain V； PDBConstruct 1–280； UniProt 1–280

Pre-mRNA-splicing factor PRP9

OrganismNot specified

UniProt P19736

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP9_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain T； PDBConstruct 1–530； UniProt 1–530

Pre-mRNA-splicing factor RDS3

OrganismNot specified

UniProt Q06835

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RDS3_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain S； PDBConstruct 1–107； UniProt 1–107

Cold sensitive U2 snRNA suppressor 1

OrganismNot specified

UniProt Q02554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CUS1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Q； PDBConstruct 1–436； UniProt 1–436

Pre-mRNA-splicing factor RSE1

OrganismNot specified

UniProt Q04693

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSE1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain P； PDBConstruct 1–1361； UniProt 1–1361

Protein HSH49

OrganismNot specified

UniProt Q99181

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HSH49_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain R； PDBConstruct 1–213； UniProt 1–213

RDS3 complex subunit 10

OrganismNot specified

UniProt P0C074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YSF3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Z； PDBConstruct 1–84； UniProt 1–84

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt Q08963

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain W； PDBConstruct 1–238； UniProt 1–238

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P40567

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MSL1_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Y； PDBConstruct 1–111； UniProt 1–111

Small nuclear ribonucleoprotein-associated protein B

OrganismNot specified

UniProt P40018

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain s； PDBConstruct 1–196； UniProt 1–196

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt Q02260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain t； PDBConstruct 1–146； UniProt 1–146

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt Q06217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain u； PDBConstruct 1–110； UniProt 1–110

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P43321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain v； PDBConstruct 1–101； UniProt 1–101

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt Q12330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain w； PDBConstruct 1–93； UniProt 1–93

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P54999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein G × 1 （P40204） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain x； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P40204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Pre-mRNA-processing ATP-dependent RNA helicase PRP5 × 1 （P21372） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain y； PDBConstruct 1–77； UniProt 1–77

Pre-mRNA-processing ATP-dependent RNA helicase PRP5

OrganismNot specified

UniProt P21372

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 19 RNA 2	U2 snRNP component HSH155 × 1 （P49955） ACT1 pre-mRNA (delta-BS-A) × 1 Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） RDS3 complex subunit 10 × 1 （P0C074） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U2 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP5_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain p； PDBConstruct 1–849； UniProt 1–849

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7oqb
Deposition date deposition_date	2021-06-03
Structure title title	The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1)
Keywords keywords	S. cerevisiae, pre-A complex, Prp5, U1 snRNP, U2 snRNP, prespliceosome, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7oqb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7oqb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7oqb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.70 Å
Rg (electron density)	75.15 Å
Total Rg	75.05 Å
Atom count	26416
Residues	4719
Excluded volume	422040 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7oqb__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	U2 snRNP component HSH155
Molecular weight formula_weight	110166.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O
Atom count atom_count	26426

MSHPIQFVNANNSDKSHQLGGQYSIPQDLRENLQKEAARIGENEKDVLQEKMETRTVQNREDSYHKRRFDMKFEPDSDTQTVTSSENTQDAVVPRKRKSRWDVKGYEPPDESSTAVKENSDSALVNVEGIHDLMFFKPSDHKYFADVISKKPIDELNKDEKKERTLSMLLLKIKNGNTASRRTSMRILTDKAVTFGPEMIFNRLLPILLDRSLEDQERHLMIKTIDRVLYQLGDLTKPYVHKILVVAAPLLIDEDPMVRSTGQEIITNLSTVAGLKTILTVMRPDIENEDEYVRNVTSRAAAVVAKALGVNQLLPFINAACHSRKSWKARHTGIKIVQQIGILLGIGVLNHLTGLMSCIKDCLMDDHVPVRIVTAHTLSTLAENSYPYGIEVFNVVLEPLWKGIRSHRGKVLSSFLKAVGSMIPLMDPEYAGYYTTEAMRIIRREFDSPDDEMKKTILLVLQKCSAVESITPKFLREEIAPEFFQKFWVRRVALDRPLNKVVTYTTVTLAKKLGCSYTIDKLLTPLRDEAEPFRTMAVHAVTRTVNLLGTADLDERLETRLIDALLIAFQEQTNSDSIIFKGFGAVTVSLDIRMKPFLAPIVSTILNHLKHKTPLVRQHAADLCAILIPVIKNCHEFEMLNKLNIILYESLGEVYPEVLGSIINAMYCITSVMDLDKLQPPINQILPTLTPILRNKHRKVEVNTIKFVGLIGKLAPTYAPPKEWMRICFELLELLKSTNKEIRRSANATFGFIAEAIGPHDVLVALLNNLKVQERQLRVCTAVAIGIVAKVCGPYNVLPVIMNEYTTPETNVQNGVLKAMSFMFEYIGNMSKDYIYFITPLLEDALTDRDLVHRQTASNVITHLALNCSGTGHEDAFIHLMNLLIPNIFETSPHAIMRILEGLEALSQALGPGLFMNYIWAGLFHPAKNVRKAFWRVYNNMYVMYQDAMVPFYPVTPDNNEEYIEELDLVL

Entity 2 Entity 2 polymer

Description description	ACT1 pre-mRNA (delta-BS-A)
Molecular weight formula_weight	101209.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	I

AUGGAUUCUGGUAUGUUCUAGCGCUUGCACCAUCCCAUUUAACUGUAAGAAGAAUUGCACGGUCCCAAUUGCUCGAGAGAUUUCUCUUUUACCUUUUUUUACUAUUUUUCACUCUCCCAUAACCUCCUAUAUUGACUGAUCUGUAAUAACCACGAUAUUAUUGGAAUAAAUAGGGGCUUGAAAUUUGGAAAAAAAAAAAAAACUGAAAUAUUUUCGUGAUAAGUGAUAGUGAUAUUCUUCUUUUAUUUGCUACUGUUACUAAGUCUCAUGUACUACAUCGAUUGCUUCAUUCUUUUUGUUGCUAUAUUAUAUGUUUAG

Entity 3 Entity 3 polymer

Description description	Pre-mRNA-splicing factor PRP11
Molecular weight formula_weight	31324.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQDEKDDQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKSSLGREGQTTHDFRQQQKXXXXXXXXXXXXXXXXIIEAKQSLKNNGTIPVCKIATVKNPKNGSVGLAIQVNYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFENIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQAEQEQADV

Entity 4 Entity 4 polymer

Description description	Pre-mRNA-splicing factor PRP21
Molecular weight formula_weight	33111.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MEPEDTQLKEDIKTTVNYIKQHGVEFENKLLEDERFSFIKKDDPLHEYYTKLMNEPTDTVSGEDNDRKSEREIARPPDFLFSQYDTGISRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFSIPEDTEIFEGSLDLEQMRLRRVQTGIKLFDSIKPTNEEEKIVSDQGKQKGGDSKGKKRKIRAVGETRLKKSKK

Entity 5 Entity 5 polymer

Description description	Pre-mRNA-splicing factor PRP9
Molecular weight formula_weight	63126.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIYKFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLEKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV

Entity 6 Entity 6 polymer

Description description	Pre-mRNA-splicing factor RDS3
Molecular weight formula_weight	12283.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MSRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKKKV

Entity 7 Entity 7 polymer

Description description	Cold sensitive U2 snRNA suppressor 1
Molecular weight formula_weight	50339.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MARTKSRKRSGNNQNKNASVVNNKAEIAAMIDARRLEQKKKGGVTNSKGKTNKVVDAKLEKEFKDVLQRFQVQENDTPKEITKDEKNNHVVIVEKNPVMNRKHTAEDELEDTPSDGIEEHLSARKRRKTEKPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPQSGLDGQDEKSLKEASRARVQPKMGALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQELRAIMNLPEGQLPPWCMKMKDIGLPTGYPDLKIAGLNWDITNLKGDVYGKIIPNHHSRSKKQGRNYFGALISFETPEFENSKEDTQANAENGRQDDKIDDEVEHKLDHFQEDISEVTSAEEKLERNEEESEKQLYTVLK

Entity 8 Entity 8 polymer

Description description	Pre-mRNA-splicing factor RSE1
Molecular weight formula_weight	153956.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MWGGGKMAVVSLSPHTAKMRKLFGQASTTMAYDGLKREAERRTRSDHNITMVAKDDELYLYHLTLKKQTNFVHSCIGHFVDLEAGSKREQSQLCVATETHLELYDTADGELKLIAKFQNLFATITSMKSLDLPHSGSRAKASNWPTFLALTSDSGNLSIVQIIMHAGALRLKTLVNQPLTRTTLRRVSPISYMEIDPNGRCIILSSVEQNKLCFLVDYAQKLRISSPLEIIRPHMVTLDMAVVDVNFNNPCFVTLEIDNAATQLSVHLIFYVLELGLNHIVKKADYLVNPSANFVLSLPDLSRYNITTSLSDNNYDADYDTLFNPFVVIGFENHILVKDMNGFFSLKVEIPKRSITNSRHKNVTIISGIVQKLKNDFFVLLQSNHGDLFKLTVSPDTNDRNRPLVQLSYFDTIQNSHQLHIFKNGYLFALSEMNNNFLFQFEKLGVEKNDFSNVLTSKDPNKSLVFEPSIKLQNLSILSQQLNLNPSIKSQIVSDSPLSIATKHFTNNKIITLTNAVNYSNLISTSLPPNATKLWLIPDPATTGDNNTLLFITFPKKTMILQIDNESMEELTPDEATRSAFKLSQDTTIHTCLMGSHSIIQVCTAELRHIVPTGKSRYSNKLTWVPPAGIRIVCATSSKTQLIISLSNYELVYFKIDVSSDSLIELTTHPELDTMPSKVAIVQDTQHADLLAIADNEGMIKIMSLKDQKEDFLTVISLQLVSEKISDMIMVRDSSIGQLNLHVGLENGVYMKFHIGDVDGSFTDIKRRFLGLKPVSLSYLREISVSLNNEEEEEEEEDDDDEKEEEEINSSGAKWMSCVVCHSSSTWVSYTWKNVWTIRQLKDQNMLSCSKFVNADVAINGVCSISSSGRLNIGRVSNFPTLDNWFHVHESSVNKQENGGGDESNEEEEDEMEEEMEMLQISTFRPRTILSFPNNPKSILFIDNHSGKKQCRISLQIDGECLKFGSSDHLYKILDDIDCVSAAIIDFTRQADHLIICAGDKRLLTYKILVNKDKLSFDIELLHQTEIISPIHAMLKFKNFLLTAMGSTIVLYGLGKKQLLRRSVTQTPVSITKIVSMHQWNYERLAVGDIHESVTLFIWDPAGNVFIPYVDDSVKRHVTVLKFLDEATVIGADRYGNAWTLRSPPECEKIMSNHDPSELSNGAIKYPLDVITLQQKLPNTYDCKFKFQLLNHFFVNDIITDFHILDSLSNSDRPGCIYMGLQGTVGCFIPLLSKGNVFMMGNIENIMAEADDTFYLDYESRKKNNNMRKEDDEEESGSVVLQGRHGIEDEIICEGSCSILGRDHQEYRSYYAPVRKVIDGDLCENFLRLSLNEQEFLAKNLKSVQVEDIIQTINEVRTNYM

Entity 9 Entity 9 polymer

Description description	Protein HSH49
Molecular weight formula_weight	24534.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MNYSADSGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGKLIREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFKENGKGNAKYGDDVDRLLNKEALKHNMLK

Entity 10 Entity 10 polymer

Description description	RDS3 complex subunit 10
Molecular weight formula_weight	9888.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAEKQRQLKLQKIYKQKYIGLGDESTTREQWQRNVRNDTLNTLQGHSASLEYVSLSRGDLSIRDTRIHLLKSMSPGYKAYLREE

Entity 11 Entity 11 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	27232.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MKFTPSIVIDAPQYYVDHFNGKYNVDKCVILRDLQLETDSESMPSSLKHLTKPTHILDLTNNDLIMIPDLSRRDDIHTLLLGRNNIVEVDGRLLPMNVQNLTLSNNSIRRFEDLQRLRRAPRTLKNLTLIGNQVCHLANYREHVLRLVPHLETLDFQNVTAEERKSAMSFPRQADGDTLGPVNTAIRDNGSRDKTMEIMNLVVSKMTVERRNELKKQLAEATSLEEIARLEKLLSGGV

Entity 12 Entity 12 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	12850.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MVEPARKKQRIDRDTHHTVAEPVTEAKNTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL

Entity 13 Entity 13 polymer

Description description	Small nuclear ribonucleoprotein-associated protein B
Molecular weight formula_weight	22427.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK

Entity 14 Entity 14 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	16296.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL

Entity 15 Entity 15 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	12876.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MSSQIIDRPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTPVE

Entity 16 Entity 16 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	11240.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR

Entity 17 Entity 17 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10270.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSA

Entity 18 Entity 18 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9669.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN

Entity 19 Entity 19 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8490.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI

Entity 20 Entity 20 polymer

Description description	Pre-mRNA-processing ATP-dependent RNA helicase PRP5
Molecular weight formula_weight	96512.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

METIDSKQNINRESLLEERRKKLAKWKQKKAQFDAQKEHQTSRNDIVTNSLEGKQTTEKFTERQERVKEELRKRKNEFRKSDEPVSVKPSKKKSKRSKVKKKISFDFSDDDDSEIGVSFRSKEHIQKAPEHDNEKDPLDEFMTSLKEEKMSNSKGMYDRGDILDVEDQLFELGGTDDEDVEDNTDNSNIAKIAKLKAKKRVKQIYYSPEELEPFQKNFYIESETVSSMSEMEVEELRLSLDNIKIKGTGCPKPVTKWSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQITDLKRGTEIVVATPGRFIDILTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDNLVQLIHERSEFFDEVQSENDGQSSDVEEVDAKAIIFVSSQNICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLLLHDELSGAYILSKAMRDEEIKALDPLQAKELQEMSAKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNKDLELKKNDKRSDDLEKKISNPREGHDSVSESSALIPRLNYELFKESTDGSIIFYAKVYINDLPQIVRWEATKNTTLLFIKHETGCSITNKGKFYPEGKEPKNENDEPKLYLLIEGQDEKDIQLSIELLEQKVKEGVVKAASLSLKSTKY

Entity 21 Entity 21 polymer

Description description	U2 snRNA
Molecular weight formula_weight	376267.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

ACGAAUCUCUUUGCCUUUUGGCUUAGAUCAAGUGUAGUAUCUGUUCUUUUCAGUGUAACAACUGAAAUGACCUCAAUGAGGCUCAUUACCUUUUAAUUUGUUACAAUACACAUUUUUUGGCACCCAAAAUAAUAAAAUGGACGGGAAGAGACUUUUUAAGCAAGUUGUUUUCCGCUAAUGUCAGGUCUCACUACUUUUUGCUGCUAUUUUUCUUCGCUCAUGGUUUCUUCAUAAGGCGUUUUUAUGAUGGUUUUUCGAAAUUGGUUUUUGAGACGACGGUUGCUCAAGGUUAUUGUUUUUGUUUUCUUCUGGUUGUUUUCUAUUUUCUUUUUUUUAGCUUUCUGUUUCUCCCUUAGUUUGGCUUUUUGCUUCAUACUCUUCCCUGUCUUUCCGAGCCGUUUAUGUCCAACGCGGGAUUUGGUUUUUCUUUAUCGAUGGGAAGAAAUGGUGCUAUAGUAGGUUGGGAGAUAAUAUUUAUGGUAUGGGGUGCUAGUGCGGAUGGGGCGCUCUUAUUGUUGAUUUCUUCGCUCGUCUUCUUUUUCUGGUGGCGCUGCAAGAGGAAGUUUUUCGACUUUGUUAUGAUUUUUGGUUUGCAAGGAAAGGUGUCUUACGAUUCUUUUUUUGAUGUAAUAGGAUAAGCUUGCUUAUCCCCCAAGUAUCGGCCAAAGUUGUUGAUUUUCCUUUUGAAGUGUCCUCGGUUUGAGGGGGUGUAGGGUGGGGUUGGUCUACAAUAAGAGUGUUCCAUUGUUAACGUGCUGGCGUCUUUUACUAUAUUUUUUUUCCCAGUUUAUUUUGUGCUUAUUUUCUCAUUGAGGAGAAGGAGCUCUUCUCGCAGGAUAUAAAUGGAGGUUUGCUAAAGGGGAGGAGAUGUGUUUGUGAGAAUACUGCUGAGAGAGUUCUGGAAGAGAAAAAAAGGAGGCAAUGGAAGGCGUUUGCUGGGAAAAGAGAAGAGCCAUGACUGCAUCUGUUGUUUCAAGGCCAGUUUUAUUAACCGCCUAUGUCAUAGAGGCGUUUUUUUUGGAGGGAUUUGAAGAAUGCCGGCGGCAUCAAGAAACGGACUUGAUGGUUGACGCCUGUUUUUAAAGUUAGAGACGUCGCGACCCUCGCACUUGUGGAGUCGUUCUUGACUUUUACUUUGGUCGCUUGAUGUUUCUCUCGUCUUCCCGUUCGCUCUU

▶

Resolution resolution	9.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	160894

The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

U2 snRNP component HSH155

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor PRP11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor PRP21

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor PRP9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor RDS3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cold sensitive U2 snRNA suppressor 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor RSE1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein HSH49

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RDS3 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;U2 small nuclear ribonucleoprotein A' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer