6g90

Prespliceosome structure provides insight into spliceosome assembly and regulation (map A2)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ;

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU1A_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–118； UniProt 1–118 Author chain A； PDBConstruct 149–298； UniProt 149–298

;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ;

OrganismNot specified

UniProt Q00916

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU17_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–57； UniProt 1–57 Author chain B； PDBConstruct 89–300； UniProt 89–300

U1 small nuclear ribonucleoprotein C

OrganismNot specified

UniProt Q05900

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU1C_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain C； PDBConstruct 1–231； UniProt 1–231

Pre-mRNA-processing factor 39

OrganismNot specified

UniProt P39682

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP39_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D； PDBConstruct 1–629； UniProt 1–629

U1 small nuclear ribonucleoprotein component PRP42

OrganismNot specified

UniProt Q03776

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP42_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain E； PDBConstruct 1–544； UniProt 1–544

Protein NAM8

OrganismNot specified

UniProt Q00539

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NAM8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain F； PDBConstruct 1–523； UniProt 1–523

56 kDa U1 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q03782

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNU56_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain G； PDBConstruct 1–492； UniProt 1–492

Protein LUC7,Protein LUC7,Protein LUC7

OrganismNot specified

UniProt Q07508

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LUC7_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–261； UniProt 1–261

U1 small nuclear ribonucleoprotein component SNU71

OrganismNot specified

UniProt P53207

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNU71_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain J； PDBConstruct 1–620； UniProt 1–620

U2 snRNP component HSH155

OrganismNot specified

UniProt P49955

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–971； UniProt 1–971

Pre-mRNA-splicing factor RSE1

OrganismNot specified

UniProt Q04693

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSE1_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain P； PDBConstruct 1–1361； UniProt 1–1361

Cold sensitive U2 snRNA suppressor 1

OrganismNot specified

UniProt Q02554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CUS1_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Q； PDBConstruct 1–435； UniProt 1–435

Protein HSH49

OrganismNot specified

UniProt Q99181

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HSH49_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain R； PDBConstruct 1–213； UniProt 1–213

Pre-mRNA-splicing factor RDS3

OrganismNot specified

UniProt Q06835

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RDS3_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain S； PDBConstruct 1–107； UniProt 1–107

Pre-mRNA-splicing factor PRP9

OrganismNot specified

UniProt P19736

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP9_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain T； PDBConstruct 1–530； UniProt 1–530

Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11

OrganismNot specified

UniProt Q07350

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP11_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain U； PDBConstruct 1–114； UniProt 1–114 Author chain U； PDBConstruct 137–266； UniProt 137–266

Pre-mRNA-splicing factor PRP21

OrganismNot specified

UniProt P32524

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP21_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain V； PDBConstruct 1–280； UniProt 1–280

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt Q08963

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 1–238； UniProt 1–238

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P40567

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MSL1_YEAST
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Y； PDBConstruct 1–111； UniProt 1–111

RDS3 complex subunit 10

OrganismNot specified

UniProt P0C074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YSF3_YEAST
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Z； PDBConstruct 1–85； UniProt 1–85

Small nuclear ribonucleoprotein-associated protein B

OrganismNot specified

UniProt P40018

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_YEAST
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain b； PDBConstruct 1–196； UniProt 1–196 Author chain s； PDBConstruct 1–196； UniProt 1–196

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P43321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_YEAST
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain d； PDBConstruct 1–101； UniProt 1–101 Author chain v； PDBConstruct 1–101； UniProt 1–101

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt Q12330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_YEAST
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain e； PDBConstruct 1–94； UniProt 1–94 Author chain w； PDBConstruct 1–94； UniProt 1–94

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P54999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_YEAST
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain f； PDBConstruct 1–86； UniProt 1–86 Author chain x； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P40204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_YEAST
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain g； PDBConstruct 1–77； UniProt 1–77 Author chain y； PDBConstruct 1–77； UniProt 1–77

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt Q02260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_YEAST
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain h； PDBConstruct 1–146； UniProt 1–146 Author chain t； PDBConstruct 1–146； UniProt 1–146

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt Q06217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 35 RNA 3	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_YEAST
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain i； PDBConstruct 1–110； UniProt 1–110 Author chain u； PDBConstruct 1–110； UniProt 1–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6g90
Deposition date deposition_date	2018-04-10
Structure title title	Prespliceosome structure provides insight into spliceosome assembly and regulation (map A2)
Keywords keywords	Spliceosome, A complex, RNA processing, RNA-protein complex, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6g90__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6g90__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6g90__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	88.57 Å
Rg (electron density)	89.06 Å
Total Rg	89.02 Å
Atom count	65050
Residues	7479
Excluded volume	1126500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6g90__assembly_1__model_1`	38-meric （38）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Description description	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA
Molecular weight formula_weight	126116.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	1
Atom count atom_count	65050

AUACUUACCUUAAGAUAUCAGAGGAGAUCAAGAAGUCCUACUGAUCAAACAUGCGCUUCCAAUAGUAGAAGGACGUUAAGCAUUUAUCAUUGAACUAUAAUUGUUCAUUGAAGUCAUUGAUGCAAACUCCUUGGUCACACACACAUACGGCGCGGAAGGCGUGUUUGCUGACGUUUCCAUUCCCUUGUUUCAAUCAUUGGUUAAUCCCUUGAUUCCUUUGGGGAUUUUUGGGUUAAACUGAUUUUUGGGGCCCUUUGUUUCUUCUGCCUGGAGAAGUUUGACACCAAAUUCAAAUUGGUGUUAGGGGAGCUGGGGCCUUUCAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNUUUUGGAAGGUCUUGGUCGGGUGGAUCUUAUAAUUUUUGAUUUAUUUU

Entity 2 Entity 2 polymer

Description description	U2 snRNA
Molecular weight formula_weight	45762.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

AAGUGUAGUAUCUGUUCUUUUCAGUGUAACAACUGAAAUGACCUAGGCUCAUACACAUUUUUUGGCAGGACGGGAAGAGGAGACGUCGCGACCCUCGCAGAGUCGUUCUUGACUUGGUCGCUUGAUGUUUCUUCUUCCCGUUC

Entity 3 Entity 3 polymer

Description description	;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ;
Molecular weight formula_weight	33754.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSALYFQNLPSRPANKENYTRLLLKHINPNNKYAINPSLPLPHNKLQISSQPLMLLDDQMGLLEVSISRSSKMTNQAFLTFVTQEEADRFLEKYTTTALKVQGRKVRMGKARTNSLLGXXXXXQKKKGNDETYXXXXXXXXXXXXXXXKLRSDDICAKKFRLKRQIRRLKHKLRSRKVEEAEIDRIVKEFETRRLENMKSQQENLKQSQKPLKRAKVSNTMENPPNKVLLIQNLPSGTTEQLLSQILGNEALVEIRLVSVRNLAFVEYETVADATKIKNQLGSTYKLQNNDVTIGFAK

Entity 4 Entity 4 polymer

Description description	;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ;
Molecular weight formula_weight	33445.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MNYNLSKYPDDVSRLFKPRPPLSYKRPTDYPYAKRQTNPNITGVANLLSTSLKHYMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQNWNPNVDPHIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICIVDIERGRTVKYFKPRRLGGGLGGRGYSNRDSRLPGRFASASTSNPAERNYAPRLPRRETSSSAYSADRYGSSTLDARYRGNRPLLSAATPTAAVTSVYKSRNSRTRESQPAPKEAPDY

Entity 5 Entity 5 polymer

Description description	U1 small nuclear ribonucleoprotein C
Molecular weight formula_weight	27106.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQTSRSRDETCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVDILQTTIKESKKRMHSDGIRKPSSANGYKRRRYGN

Entity 6 Entity 6 polymer

Description description	Pre-mRNA-processing factor 39
Molecular weight formula_weight	74834.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MPDETNFTIEDIEPRPDALRGLDTQFLQDNTALVQAYRGLDWSDISSLTQMVDVIEQTVVKYGNPNDSIKLALETILWQILRKYPLLFGFWKRFATIEYQLFGLKKSIAVLATSVKWFPTSLELWCDYLNVLCVNNPNETDFIRNNFEIAKDLIGKQFLSHPFWDKFIEFEVGQKNWHNVQRIYEYIIEVPLHQYARFFTSYKKFLNEKNLKTTRNIDIVLRKTQTTVNEIWQFESKIKQPFFNLGQVLNDDLENWSRYLKFVTDPSKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWLTKKNISDEVVVDIYQKANTFLPLDFKTLRYDFLRFLKRKYRSNNTLFNNIFNETVSRYLKIWPNDILLMTEYLCMLKRHSFKNSLDQSPKEILEKQTSFTKILETSITNYINNQIDAKVHLQTLINDKNLSIVVVELIKTTWLVLKNNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKSNVNFTKLNKFIRELGVEIYLPTTVMNDILTDYKTFYLTHSNIVTYESSIIDSNTFDPILYPELKMSNPKYDPVLNTTANVDWHKKTEWKEAGHIGITTERPQISNSIIECNSGTLIQKPISLPNFRNLEKINQVKINDLYTEEFLKEGK

Entity 7 Entity 7 polymer

Description description	U1 small nuclear ribonucleoprotein component PRP42
Molecular weight formula_weight	65222.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDKYTALIHDENFSTLTLNVSRYPKSLAYWEKLLNYIVKASAPICKSTEPQLLKLIRCTYSSMLNEFPYLENYYIDFALLEYKLGNVSMSHKIFQRGLQAFNQRSLLLWTSYLKFCNNVISHQKQLFKKYETAEEYVGLHFFSGEFWDLYLEQISSRCTSSKKYWNVLRKILEIPLHSFSKFYALWLQRIDDIMDLKQLSQLTSKDELLKKLKIDINYSGRKGPYLQDAKKKLKKITKEMYMVVQYQVLEIYSIFESKIYINYYTSPETLVSSDEIETWIKYLDYTITLQTDSLTHLNFQRALLPLAHYDLVWIKYSKWLINSKNDLLGAKNVLLMGLKFSLKKTEIIKLLYSVICKLNEYVLLRNLLEKIESSYSDNVENVDDFEIFWDYLQFKTFCQNSLYSSRYSDSQSNGLLNKELFDKVWKRLSCKEKKSGQEILLNNLVQFYSKDTVEFVEKNIFQKIIEFGWEYYLQNGMFWNCYCRLIYFDTSRSYLDKRQYIVRKIWPQIDKKFAQSVLPSLTEFCESYFPEEMDTLEEMFTEEP

Entity 8 Entity 8 polymer

Description description	Protein NAM8
Molecular weight formula_weight	57010.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSYKQTTYYPSRGNLVRNDSSPYTNTISSETNNSSTSVLSLQGASNVSLGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPSSTHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSAKQTALLQQAMLSNSLQVQQQQPGLQQPNYGYIPSSTCEAPVLPDNNVSSTMLPGCQILNYSNPYANANGLGSNNFSFYSNNNATNTQATSLLADTSSMDLSGTGGQQVIMQGSEAVVNSTNAMLNRLEQGSNGFMFA

Entity 9 Entity 9 polymer

Description description	56 kDa U1 small nuclear ribonucleoprotein component
Molecular weight formula_weight	56575.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MRPRRRGLAYHHTKPKGQLSQGHYPTTSNDGQRRKVGNSEAFQSFDIWKNLDRIRSTKKNAGQFIKGSLLILPMRTEDKQQFDECMDELHKYISKDILRCYPQKEQKDEGMLFYIVLKDFNILDSCFVLSVLLAFQKRLWMAPSEKSYFRVPKNINLTGSFYLPKNIETGRGHIITSYRREQPSSSIVEVGFNVVPDFQQFQVKACHVSKFMNELSNFFSQVEFGKCEANVINYFKREYNRTYSQISLALYELPLIGDGLFDIKSYISKTRPIIETSKAQMIKHISEMKAYNEISGLQGDQFPRQQRPLSNSPSSNSISSSQTIEAGATSYQTQPQRHAVNKPSNVLNSSNRHSGPKTFEDGRYSEGNKPGFMTQDEIKQHCIGTIKASMDAVKKKSSYQILKTYVRCPRQNYIDIVYQNLNDLRSKTNCNIVVLNLNNLHESQMWLESLNTTNYTIFAQAPHPSTIRVISIGGVGEYIVKALELILNILEH

Entity 10 Entity 10 polymer

Description description	Protein LUC7,Protein LUC7,Protein LUC7
Molecular weight formula_weight	28504.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSTMSTPAAEQRKLVEQLMGRDFSFRHNRYSHQKRDLGLHDPKICKSYLVGECPYDLFQGTKQSLGKCPQMHLTKHKIQYERVEKQGKTFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQEIDSLIRADEVSMGMLQSVKLQELISKRKEVAKRVRNITENVGQSAQQKLQVCEVCGAYLSRLDTDRRLADHFLGKIHLGYVKMREDYDRLMKNNRTTNASKTATTLPGRRFV

Entity 11 Entity 11 polymer

Description description	Yeast UBC4 pre-mRNA (mutant)
Molecular weight formula_weight	12045.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	I

AGGUAUGUCUAACUUCUCUUAUUUACAAACAAAAUCAA

Entity 12 Entity 12 polymer

Description description	U1 small nuclear ribonucleoprotein component SNU71
Molecular weight formula_weight	71484.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDIVFVSPQLYLSSQEGWKSDSAKSGFIPILKNDLQRFQDSLKHIVDARNSLSETLLNSNDDGSIHNSDQNTGLNKDKEASIADNNSANKCATSSSRYQELKQFLPISLDQQIHTVSLQGVSSSFSRGQIESLLDHCLNLALTETQSNSALKVEAWSSFSSFLDTQDIFIRFSKVDEDEAFVNTLNYCKALFAFIRKLHEDFKIELHLDLNTKEYVEDRTGTIPSVKPEKASEFYSVFKNIEDQTDERNSKKEQLDDSSTQYKVDTNTLSDLPSDALDQLCKDIIEFRTKVVSIEKEKKMKSTYEESRRQRHQMQKVFDQIRKNHSGAKGSANTEEEDTNMEDEDEEDDTEDDLALEKRKEERDLEESNRRYEDMLHQLHSNTEPKIKSIRADIMSAENYEEHLEKNRSLYLKELLHLANDVHYDHHRSFKEQEERRDEEDRAKNGNAKELAPIQLSDGKAISAGKAAAITLPEGTVKSENYNADKNVSESSEHVKIKFDFKKAIDHSVESSSEDEGYRESELPPTKPSERSAAEDRLPFTADELNIRLTNLKESRYVDELVREFLGVYEDELVEYILENIRVNQSKQALLNELRETFDEDGETIADRLWSRKEFRLGT

Entity 13 Entity 13 polymer

Description description	U2 snRNP component HSH155
Molecular weight formula_weight	110166.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSHPIQFVNANNSDKSHQLGGQYSIPQDLRENLQKEAARIGENEKDVLQEKMETRTVQNREDSYHKRRFDMKFEPDSDTQTVTSSENTQDAVVPRKRKSRWDVKGYEPPDESSTAVKENSDSALVNVEGIHDLMFFKPSDHKYFADVISKKPIDELNKDEKKERTLSMLLLKIKNGNTASRRTSMRILTDKAVTFGPEMIFNRLLPILLDRSLEDQERHLMIKTIDRVLYQLGDLTKPYVHKILVVAAPLLIDEDPMVRSTGQEIITNLSTVAGLKTILTVMRPDIENEDEYVRNVTSRAAAVVAKALGVNQLLPFINAACHSRKSWKARHTGIKIVQQIGILLGIGVLNHLTGLMSCIKDCLMDDHVPVRIVTAHTLSTLAENSYPYGIEVFNVVLEPLWKGIRSHRGKVLSSFLKAVGSMIPLMDPEYAGYYTTEAMRIIRREFDSPDDEMKKTILLVLQKCSAVESITPKFLREEIAPEFFQKFWVRRVALDRPLNKVVTYTTVTLAKKLGCSYTIDKLLTPLRDEAEPFRTMAVHAVTRTVNLLGTADLDERLETRLIDALLIAFQEQTNSDSIIFKGFGAVTVSLDIRMKPFLAPIVSTILNHLKHKTPLVRQHAADLCAILIPVIKNCHEFEMLNKLNIILYESLGEVYPEVLGSIINAMYCITSVMDLDKLQPPINQILPTLTPILRNKHRKVEVNTIKFVGLIGKLAPTYAPPKEWMRICFELLELLKSTNKEIRRSANATFGFIAEAIGPHDVLVALLNNLKVQERQLRVCTAVAIGIVAKVCGPYNVLPVIMNEYTTPETNVQNGVLKAMSFMFEYIGNMSKDYIYFITPLLEDALTDRDLVHRQTASNVITHLALNCSGTGHEDAFIHLMNLLIPNIFETSPHAIMRILEGLEALSQALGPGLFMNYIWAGLFHPAKNVRKAFWRVYNNMYVMYQDAMVPFYPVTPDNNEEYIEELDLVL

Entity 14 Entity 14 polymer

Description description	Pre-mRNA-splicing factor RSE1
Molecular weight formula_weight	153956.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MWGGGKMAVVSLSPHTAKMRKLFGQASTTMAYDGLKREAERRTRSDHNITMVAKDDELYLYHLTLKKQTNFVHSCIGHFVDLEAGSKREQSQLCVATETHLELYDTADGELKLIAKFQNLFATITSMKSLDLPHSGSRAKASNWPTFLALTSDSGNLSIVQIIMHAGALRLKTLVNQPLTRTTLRRVSPISYMEIDPNGRCIILSSVEQNKLCFLVDYAQKLRISSPLEIIRPHMVTLDMAVVDVNFNNPCFVTLEIDNAATQLSVHLIFYVLELGLNHIVKKADYLVNPSANFVLSLPDLSRYNITTSLSDNNYDADYDTLFNPFVVIGFENHILVKDMNGFFSLKVEIPKRSITNSRHKNVTIISGIVQKLKNDFFVLLQSNHGDLFKLTVSPDTNDRNRPLVQLSYFDTIQNSHQLHIFKNGYLFALSEMNNNFLFQFEKLGVEKNDFSNVLTSKDPNKSLVFEPSIKLQNLSILSQQLNLNPSIKSQIVSDSPLSIATKHFTNNKIITLTNAVNYSNLISTSLPPNATKLWLIPDPATTGDNNTLLFITFPKKTMILQIDNESMEELTPDEATRSAFKLSQDTTIHTCLMGSHSIIQVCTAELRHIVPTGKSRYSNKLTWVPPAGIRIVCATSSKTQLIISLSNYELVYFKIDVSSDSLIELTTHPELDTMPSKVAIVQDTQHADLLAIADNEGMIKIMSLKDQKEDFLTVISLQLVSEKISDMIMVRDSSIGQLNLHVGLENGVYMKFHIGDVDGSFTDIKRRFLGLKPVSLSYLREISVSLNNEEEEEEEEDDDDEKEEEEINSSGAKWMSCVVCHSSSTWVSYTWKNVWTIRQLKDQNMLSCSKFVNADVAINGVCSISSSGRLNIGRVSNFPTLDNWFHVHESSVNKQENGGGDESNEEEEDEMEEEMEMLQISTFRPRTILSFPNNPKSILFIDNHSGKKQCRISLQIDGECLKFGSSDHLYKILDDIDCVSAAIIDFTRQADHLIICAGDKRLLTYKILVNKDKLSFDIELLHQTEIISPIHAMLKFKNFLLTAMGSTIVLYGLGKKQLLRRSVTQTPVSITKIVSMHQWNYERLAVGDIHESVTLFIWDPAGNVFIPYVDDSVKRHVTVLKFLDEATVIGADRYGNAWTLRSPPECEKIMSNHDPSELSNGAIKYPLDVITLQQKLPNTYDCKFKFQLLNHFFVNDIITDFHILDSLSNSDRPGCIYMGLQGTVGCFIPLLSKGNVFMMGNIENIMAEADDTFYLDYESRKKNNNMRKEDDEEESGSVVLQGRHGIEDEIICEGSCSILGRDHQEYRSYYAPVRKVIDGDLCENFLRLSLNEQEFLAKNLKSVQVEDIIQTINEVRTNYM

Entity 15 Entity 15 polymer

Description description	Cold sensitive U2 snRNA suppressor 1
Molecular weight formula_weight	50210.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MARTKSRKRSGNNQNKNASVVNNKAEIAAMIDARRLEQKKKGGVTNSKGKTNKVVDAKLEKEFKDVLQRFQVQENDTPKEITKDEKNNHVVIVEKNPVMNRKHTAEDELEDTPSDGIEEHLSARKRRKTEKPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPQSGLDGQDEKSLKEASRARVQPKMGALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQELRAIMNLPEGQLPPWCMKMKDIGLPTGYPDLKIAGLNWDITNLKGDVYGKIIPNHHSRSKKQGRNYFGALISFETPEFENSKEDTQANAENGRQDDKIDDEVEHKLDHFQEDISEVTSAEEKLERNEEESEKQLYTVL

Entity 16 Entity 16 polymer

Description description	Protein HSH49
Molecular weight formula_weight	24534.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MNYSADSGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGKLIREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFKENGKGNAKYGDDVDRLLNKEALKHNMLK

Entity 17 Entity 17 polymer

Description description	Pre-mRNA-splicing factor RDS3
Molecular weight formula_weight	12283.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MSRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKKKV

Entity 18 Entity 18 polymer

Description description	Pre-mRNA-splicing factor PRP9
Molecular weight formula_weight	63126.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIYKFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLEKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV

Entity 19 Entity 19 polymer

Description description	Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11
Molecular weight formula_weight	29292.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQDEKDDQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKSSLGREGQTTHXXXXXXXXXXXXXXXXXXXXXXVCKIATVKNPKNGSVGLAIQVNYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFENIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQAEQEQADV

Entity 20 Entity 20 polymer

Description description	Pre-mRNA-splicing factor PRP21
Molecular weight formula_weight	33111.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MEPEDTQLKEDIKTTVNYIKQHGVEFENKLLEDERFSFIKKDDPLHEYYTKLMNEPTDTVSGEDNDRKSEREIARPPDFLFSQYDTGISRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFSIPEDTEIFEGSLDLEQMRLRRVQTGIKLFDSIKPTNEEEKIVSDQGKQKGGDSKGKKRKIRAVGETRLKKSKK

Entity 21 Entity 21 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	27232.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MKFTPSIVIDAPQYYVDHFNGKYNVDKCVILRDLQLETDSESMPSSLKHLTKPTHILDLTNNDLIMIPDLSRRDDIHTLLLGRNNIVEVDGRLLPMNVQNLTLSNNSIRRFEDLQRLRRAPRTLKNLTLIGNQVCHLANYREHVLRLVPHLETLDFQNVTAEERKSAMSFPRQADGDTLGPVNTAIRDNGSRDKTMEIMNLVVSKMTVERRNELKKQLAEATSLEEIARLEKLLSGGV

Entity 22 Entity 22 polymer

Description description	Unknown
Molecular weight formula_weight	4358.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 23 Entity 23 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	12850.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MVEPARKKQRIDRDTHHTVAEPVTEAKNTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL

Entity 24 Entity 24 polymer

Description description	RDS3 complex subunit 10
Molecular weight formula_weight	10045.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAEKQRQLKLQKIYKQKYIGLGDESTTREQWQRNVRNDTLNTLQGHSASLEYVSLSRGDLSIRDTRIHLLKSMSPGYKAYLREER

Entity 25 Entity 25 polymer

Description description	Small nuclear ribonucleoprotein-associated protein B
Molecular weight formula_weight	22427.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,s

MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK

Entity 26 Entity 26 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	11240.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,v

MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR

Entity 27 Entity 27 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10385.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,w

MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD

Entity 28 Entity 28 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9669.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,x

MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN

Entity 29 Entity 29 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8490.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,y

MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI

Entity 30 Entity 30 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	16296.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,t

MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL

Entity 31 Entity 31 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	12876.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,u

MSSQIIDRPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTPVE

Entity 32 Entity 32 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	9

▼

6. Fold Classification (SCOP + CATH) 14 domains

CATH v4.4 (14 domains)

Domain ID domain_id	6g90V01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	790 — Surp module

Domain ID domain_id	6g90V02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1320 —

Domain ID domain_id	6g90Y00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	6g90d00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90e00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90f00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90g00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90i00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90s00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90u00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90v00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90w00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90x00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90y00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

▶

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	153556

Prespliceosome structure provides insight into spliceosome assembly and regulation (map A2)

1. Protein Identity and Related Structures Protein Identity & Related Structures

;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing factor 39

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein component PRP42

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein NAM8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

56 kDa U1 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein LUC7,Protein LUC7,Protein LUC7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein component SNU71

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U2 snRNP component HSH155

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer