6g90

Prespliceosome structure provides insight into spliceosome assembly and regulation (map A2)

Method: ELECTRON MICROSCOPY D_max: 311.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ;

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain A； UniProt 149–298 Chain A； UniProt 1–118	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain S 1–298（298 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain C 1–298（298 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain C 1–298（298 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain C 1–298（298 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain A 1–298（298 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain A 1–298（298 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain C 1–298（298 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RU1A_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 149–298； UniProt 149–298 Author chain A； PDBConstruct 1–118； UniProt 1–118

;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ;

OrganismNot specified

UniProt Q00916

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain B； UniProt 1–57 Chain B； UniProt 89–300	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain Q 1–300（300 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain A 1–300（300 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain A 1–300（300 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain A 1–300（300 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain B 1–300（300 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain B 1–300（300 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain A 1–300（300 aa）	Mutation：0	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RU17_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–57； UniProt 1–57 Author chain B； PDBConstruct 89–300； UniProt 89–300

U1 small nuclear ribonucleoprotein C

OrganismNot specified

UniProt Q05900

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain C； UniProt 1–231	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain R 1–231（231 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain B 1–231（231 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain B 1–231（231 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain B 1–231（231 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain C 1–231（231 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain C 1–231（231 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain B 1–231（231 aa）	Mutation：T2P,R3K,Y4F,E7D,H10D,S11T,T17S,L18P,S23T,L25C,V26S,K28R,N29K,L31K,R32E,I33N,T34V,A35K	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RU1C_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain C； PDBConstruct 1–231； UniProt 1–231

Pre-mRNA-processing factor 39

OrganismNot specified

UniProt P39682

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain D； UniProt 1–629	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain U 1–629（629 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain E 1–629（629 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain E 1–629（629 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain E 1–629（629 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain D 1–629（629 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain D 1–629（629 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain E 1–629（629 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PRP39_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D； PDBConstruct 1–629； UniProt 1–629

U1 small nuclear ribonucleoprotein component PRP42

OrganismNot specified

UniProt Q03776

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain E； UniProt 1–544	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain T 1–544（544 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain D 1–544（544 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain D 1–544（544 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain D 1–544（544 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain E 1–544（544 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain E 1–544（544 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain D 1–544（544 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PRP42_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain E； PDBConstruct 1–544； UniProt 1–544

Protein NAM8

OrganismNot specified

UniProt Q00539

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain F； UniProt 1–523	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain V 1–523（523 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain F 1–523（523 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain F 1–523（523 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain F 1–523（523 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain F 1–523（523 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain F 1–523（523 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain F 1–523（523 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NAM8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain F； PDBConstruct 1–523； UniProt 1–523

56 kDa U1 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q03782

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain G； UniProt 1–492	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain W 1–492（492 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain G 1–492（492 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain G 1–492（492 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain G 1–492（492 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain G 1–492（492 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain G 1–492（492 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain G 1–492（492 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SNU56_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain G； PDBConstruct 1–492； UniProt 1–492

Protein LUC7,Protein LUC7,Protein LUC7

OrganismNot specified

UniProt Q07508

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain H； UniProt 1–261	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain Y 1–261（261 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain I 1–261（261 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain I 1–261（261 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain H 1–261（261 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain H 1–261（261 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain I 1–261（261 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LUC7_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–261； UniProt 1–261

U1 small nuclear ribonucleoprotein component SNU71

OrganismNot specified

UniProt P53207

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain J； UniProt 1–620	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain X 1–619（619 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain H 1–52（52 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain H 1–51（51 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain H 1–620（620 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain J 1–620（620 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain J 1–620（620 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain H 1–52（52 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SNU71_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain J； PDBConstruct 1–620； UniProt 1–620

U2 snRNP component HSH155

OrganismNot specified

UniProt P49955

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain O； UniProt 1–971	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain G 1–971（971 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain Q 1–971（971 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain O 1–971（971 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain 1 1–971（971 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain 1 1–971（971 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain O 1–971（971 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain O 1–971（971 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SF3B1_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–971； UniProt 1–971

Pre-mRNA-splicing factor RSE1

OrganismNot specified

UniProt Q04693

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain P； UniProt 1–1361	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain F 1–1361（1361 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain X 1–1361（1361 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain P 1–1361（1361 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain 3 1–1361（1361 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain 3 1–1361（1361 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain P 1–1361（1361 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain P 1–1361（1361 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RSE1_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain P； PDBConstruct 1–1361； UniProt 1–1361

Cold sensitive U2 snRNA suppressor 1

OrganismNot specified

UniProt Q02554

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain Q； UniProt 1–435	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain H 1–436（436 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5LSB Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 290–368（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Equal volumes of 10-15 mg/ml protein solution were mixed with an equal volume of reservoir solution containing 2.45-2.65 M NaCl in 0.1M sodium acetate pH 4.8-4.9	Resolution 2.70 Å R-free 0.233
5LSB Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 290–368（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Equal volumes of 10-15 mg/ml protein solution were mixed with an equal volume of reservoir solution containing 2.45-2.65 M NaCl in 0.1M sodium acetate pH 4.8-4.9	Resolution 2.70 Å R-free 0.233
5LSB Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 290–368（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Equal volumes of 10-15 mg/ml protein solution were mixed with an equal volume of reservoir solution containing 2.45-2.65 M NaCl in 0.1M sodium acetate pH 4.8-4.9	Resolution 2.70 Å R-free 0.233
5LSL Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 290–368（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；18% PEG4000, 0.1M Tris HCl pH 8.5, 45 mM LiSO4	Resolution 1.65 Å R-free 0.217
5LSL Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 290–368（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；18% PEG4000, 0.1M Tris HCl pH 8.5, 45 mM LiSO4	Resolution 1.65 Å R-free 0.217
5LSL Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 290–368（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；18% PEG4000, 0.1M Tris HCl pH 8.5, 45 mM LiSO4	Resolution 1.65 Å R-free 0.217
5LSL Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 290–368（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；18% PEG4000, 0.1M Tris HCl pH 8.5, 45 mM LiSO4	Resolution 1.65 Å R-free 0.217
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain Q 1–435（435 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain 2 1–436（436 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain 2 1–436（436 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain Q 1–436（436 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain Q 1–436（436 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

8 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CUS1_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Q； PDBConstruct 1–435； UniProt 1–435

Protein HSH49

OrganismNot specified

UniProt Q99181

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain R； UniProt 1–213	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain e 1–213（213 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5LSB Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–213（212 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Equal volumes of 10-15 mg/ml protein solution were mixed with an equal volume of reservoir solution containing 2.45-2.65 M NaCl in 0.1M sodium acetate pH 4.8-4.9	Resolution 2.70 Å R-free 0.233
5LSB Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–213（212 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Equal volumes of 10-15 mg/ml protein solution were mixed with an equal volume of reservoir solution containing 2.45-2.65 M NaCl in 0.1M sodium acetate pH 4.8-4.9	Resolution 2.70 Å R-free 0.233
5LSB Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 2–213（212 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Equal volumes of 10-15 mg/ml protein solution were mixed with an equal volume of reservoir solution containing 2.45-2.65 M NaCl in 0.1M sodium acetate pH 4.8-4.9	Resolution 2.70 Å R-free 0.233
5LSL Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–100（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；18% PEG4000, 0.1M Tris HCl pH 8.5, 45 mM LiSO4	Resolution 1.65 Å R-free 0.217
5LSL Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–100（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；18% PEG4000, 0.1M Tris HCl pH 8.5, 45 mM LiSO4	Resolution 1.65 Å R-free 0.217
5LSL Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–100（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；18% PEG4000, 0.1M Tris HCl pH 8.5, 45 mM LiSO4	Resolution 1.65 Å R-free 0.217
5LSL Crystal structure of yeast Hsh49p in complex with Cus1p binding domain. Deposited 2016-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2–100（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；18% PEG4000, 0.1M Tris HCl pH 8.5, 45 mM LiSO4	Resolution 1.65 Å R-free 0.217
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain R 1–213（213 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain 4 1–213（213 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain 4 1–213（213 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain R 1–213（213 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain R 1–213（213 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

8 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HSH49_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain R； PDBConstruct 1–213； UniProt 1–213

Pre-mRNA-splicing factor RDS3

OrganismNot specified

UniProt Q06835

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain S； UniProt 1–107	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2K0A 1H, 15N and 13C chemical shift assignments for Rds3 protein Deposited 2008-01-31	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–107（106 aa）	Not recorded	ZN ZINC ION × 3	SOLUTION NMR NMR measurement conditions pH 7；300 K；Ionic strength (raw mmCIF value) 200；Pressure ambient NMR sample composition 350 uM [U-98% 15N] Rds3p, 20 mM [U-99% 2H] Tris buffer, 200 mM sodium chloride, 1 mM [U-99% 2H] DTT, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 700 uM [U-98% 13C; U-98% 15N] Rds3p, 20 mM [U-99% 2H] Tris buffer, 200 mM sodium chloride, 1 mM [U-99% 2H] DTT, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain J 1–107（107 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain Y 1–107（107 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain S 1–107（107 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain 5 1–107（107 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain 5 1–107（107 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain S 1–107（107 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain S 1–107（107 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RDS3_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain S； PDBConstruct 1–107； UniProt 1–107

Pre-mRNA-splicing factor PRP9

OrganismNot specified

UniProt P19736

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain T； UniProt 1–530	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4DGW Crystal Structure of the SF3a splicing factor complex of U2 snRNP Deposited 2012-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–389（389 aa） Fragment：N-terminal domain, UNP residues 1-389	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；290 K；8-12% Ethanol, 100mM MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 3.11 Å R-free 0.278
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain T 1–530（530 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain u 1–530（530 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain u 1–530（530 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain T 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain T 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PRP9_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain T； PDBConstruct 1–530； UniProt 1–530

Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11

OrganismNot specified

UniProt Q07350

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain U； UniProt 1–114 Chain U； UniProt 137–266	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4DGW Crystal Structure of the SF3a splicing factor complex of U2 snRNP Deposited 2012-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 50–266（217 aa） Fragment：C-terminal domain, UNP residues 50-266	Mutation：L153M Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；290 K；8-12% Ethanol, 100mM MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 3.11 Å R-free 0.278
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain I 1–266（266 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain U 1–266（266 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain v 1–266（266 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain v 1–266（266 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain U 1–266（266 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain U 1–266（266 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PRP11_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain U； PDBConstruct 1–114； UniProt 1–114 Author chain U； PDBConstruct 137–266； UniProt 137–266

Pre-mRNA-splicing factor PRP21

OrganismNot specified

UniProt P32524

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain V； UniProt 1–280	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4DGW Crystal Structure of the SF3a splicing factor complex of U2 snRNP Deposited 2012-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 87–237（151 aa） Fragment：Middle domain, UNP residues 87-237	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；290 K；8-12% Ethanol, 100mM MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 3.11 Å R-free 0.278
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain V 1–280（280 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain w 1–280（280 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain w 1–280（280 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7DCO Cryo-EM structure of the activated spliceosome (Bact complex) at an atomic resolution of 2.5 angstrom Deposited 2020-10-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 56-meric	Chain w 1–280（280 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 CA CALCIUM ION × 1 ZN ZINC ION × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain V 1–280（280 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain V 1–280（280 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PRP21_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain V； PDBConstruct 1–280； UniProt 1–280

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt Q08963

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain W； UniProt 1–238	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain b 1–238（238 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain W 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain W 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain W 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain W 1–238（238 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain Y 1–238（238 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain o 1–238（238 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain o 1–238（238 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain o 1–238（238 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain o 1–238（238 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain s 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain W 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain b 1–238（238 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain b 1–238（238 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain b 1–238（238 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain b 1–238（238 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain W 1–238（238 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain W 1–238（238 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain W 1–238（238 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

19 other PDB entries and 19 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RU2A_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 1–238； UniProt 1–238

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P40567

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain Y； UniProt 1–111	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain a 1–111（111 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain Y 1–111（111 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain Y 1–111（111 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain Y 1–111（111 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain Y 1–111（111 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain X 1–111（111 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain p 1–111（111 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain p 1–111（111 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain p 1–111（111 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain p 1–111（111 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain r 1–111（111 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain Y 1–111（111 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain a 1–111（111 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain a 1–111（111 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain a 1–111（111 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain a 1–111（111 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain Y 1–111（111 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain Y 1–111（111 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain Y 1–111（111 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

19 other PDB entries and 19 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MSL1_YEAST
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Y； PDBConstruct 1–111； UniProt 1–111

RDS3 complex subunit 10

OrganismNot specified

UniProt P0C074

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain Z； UniProt 1–85	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain K 1–85（85 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain Z 1–85（85 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain Z 1–85（85 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain 6 1–85（85 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain 6 1–85（85 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7DCO Cryo-EM structure of the activated spliceosome (Bact complex) at an atomic resolution of 2.5 angstrom Deposited 2020-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 56-meric	Chain 6 1–84（84 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 CA CALCIUM ION × 1 ZN ZINC ION × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain Z 1–84（84 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain Z 1–85（85 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	YSF3_YEAST
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Z； PDBConstruct 1–85； UniProt 1–85

Small nuclear ribonucleoprotein-associated protein B

OrganismNot specified

UniProt P40018

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain b； UniProt 1–196 Chain s； UniProt 1–196	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3JCM Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 34-meric	Chain O 1–196（196 aa） Chain S 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 M7M N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5GAM Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: Dodecameric	Chain b 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAN The overall structure of the yeast spliceosomal U4/U6.U5 tri-snRNP at 3.7 Angstrom Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 35-meric	Chain b 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAO Head region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: 11-meric	Chain k 1–196（196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 4.20 Å
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain k 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain k 1–196（196 aa） Chain s 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain b 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain b 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain b 1–196（196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5MPS Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 25 PDB declaration: 30-meric	Chain b 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 3.85 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain b 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain b 1–196（196 aa） Chain k 1–196（196 aa） Chain s 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain F 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain a 1–196（196 aa） Chain h 1–196（196 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain a 1–196（196 aa） Chain h 1–196（196 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain P 1–196（196 aa） Chain a 1–196（196 aa） Chain h 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain a 1–196（196 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain P 1–196（196 aa） Chain a 1–196（196 aa） Chain h 1–196（196 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain f 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain b 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain k 1–196（196 aa） Chain s 1–196（196 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain k 1–196（196 aa） Chain s 1–196（196 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain k 1–196（196 aa） Chain s 1–196（196 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain k 1–196（196 aa） Chain s 1–196（196 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain K 1–196（196 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain K 1–196（196 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain K 1–196（196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7B9V Yeast C complex spliceosome at 2.8 Angstrom resolution with Prp18/Slu7 bound Deposited 2020-12-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 45 PDB declaration: 50-meric	Chain b 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 6 K POTASSIUM ION × 1 KGN D-chiro inositol hexakisphosphate × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain s 1–196（196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain b 1–196（196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain b 1–196（196 aa） Chain s 1–196（196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain K 1–196（196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain b 1–196（196 aa） Chain k 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

33 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RSMB_YEAST
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain b； PDBConstruct 1–196； UniProt 1–196 Author chain s； PDBConstruct 1–196； UniProt 1–196

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P43321

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain d； UniProt 1–101 Chain v； UniProt 1–101	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3JCM Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 34-meric	Chain J 1–101（101 aa） Chain R 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 M7M N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5GAM Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: Dodecameric	Chain d 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAN The overall structure of the yeast spliceosomal U4/U6.U5 tri-snRNP at 3.7 Angstrom Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 35-meric	Chain d 1–101（101 aa） Chain n 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAO Head region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: 11-meric	Chain n 1–101（101 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 4.20 Å
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain l 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain l 1–101（101 aa） Chain y 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain d 1–101（101 aa） Chain n 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain d 1–101（101 aa） Chain n 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain d 1–101（101 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5MPS Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 25 PDB declaration: 30-meric	Chain d 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 3.85 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain d 1–101（101 aa） Chain n 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain d 1–101（101 aa） Chain n 1–101（101 aa） Chain v 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain U 1–101（101 aa） Chain l 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain e 1–101（101 aa） Chain l 1–101（101 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain e 1–101（101 aa） Chain l 1–101（101 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain S 1–101（101 aa） Chain d 1–101（101 aa） Chain l 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain d 1–101（101 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain S 1–101（101 aa） Chain d 1–101（101 aa） Chain l 1–101（101 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain g 1–101（101 aa） Chain o 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain d 1–101（101 aa） Chain n 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain l 1–101（101 aa） Chain y 1–101（101 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain l 1–101（101 aa） Chain y 1–101（101 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain l 1–101（101 aa） Chain y 1–101（101 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain l 1–101（101 aa） Chain y 1–101（101 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain N 1–101（101 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain N 1–101（101 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain N 1–101（101 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7B9V Yeast C complex spliceosome at 2.8 Angstrom resolution with Prp18/Slu7 bound Deposited 2020-12-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 45 PDB declaration: 50-meric	Chain d 1–101（101 aa） Chain n 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 6 K POTASSIUM ION × 1 KGN D-chiro inositol hexakisphosphate × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain v 1–101（101 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain d 1–101（101 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain d 1–101（101 aa） Chain v 1–101（101 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain N 1–101（101 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain d 1–101（101 aa） Chain n 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

33 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SMD3_YEAST
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain d； PDBConstruct 1–101； UniProt 1–101 Author chain v； PDBConstruct 1–101； UniProt 1–101

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt Q12330

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain e； UniProt 1–94 Chain w； UniProt 1–94	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3JCM Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 34-meric	Chain V 1–94（94 aa） Chain Y 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 M7M N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5GAM Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: Dodecameric	Chain e 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAN The overall structure of the yeast spliceosomal U4/U6.U5 tri-snRNP at 3.7 Angstrom Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 35-meric	Chain e 1–94（94 aa） Chain p 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAO Head region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: 11-meric	Chain p 1–94（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 4.20 Å
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain i 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain i 1–94（94 aa） Chain u 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain e 1–94（94 aa） Chain p 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain e 1–94（94 aa） Chain p 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain e 1–94（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5MPS Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 25 PDB declaration: 30-meric	Chain e 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 3.85 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain e 1–94（94 aa） Chain p 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain e 1–94（94 aa） Chain p 1–94（94 aa） Chain w 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain G 1–94（94 aa） Chain i 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain b 1–94（94 aa） Chain i 1–94（94 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain b 1–94（94 aa） Chain i 1–94（94 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain T 1–94（94 aa） Chain e 1–94（94 aa） Chain i 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain e 1–94（94 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain T 1–94（94 aa） Chain e 1–94（94 aa） Chain i 1–94（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain c 1–94（94 aa） Chain l 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain e 1–94（94 aa） Chain p 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain i 1–94（94 aa） Chain u 1–94（94 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain i 1–94（94 aa） Chain u 1–94（94 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain i 1–94（94 aa） Chain u 1–94（94 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain i 1–94（94 aa） Chain u 1–94（94 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain O 1–94（94 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain O 1–94（94 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain O 1–94（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7B9V Yeast C complex spliceosome at 2.8 Angstrom resolution with Prp18/Slu7 bound Deposited 2020-12-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 45 PDB declaration: 50-meric	Chain e 1–94（94 aa） Chain p 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 6 K POTASSIUM ION × 1 KGN D-chiro inositol hexakisphosphate × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain w 1–93（93 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain e 1–94（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain e 1–94（94 aa） Chain w 1–94（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain O 1–94（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain e 1–94（94 aa） Chain p 1–94（94 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

33 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RUXE_YEAST
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain e； PDBConstruct 1–94； UniProt 1–94 Author chain w； PDBConstruct 1–94； UniProt 1–94

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P54999

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain f； UniProt 1–86 Chain x； UniProt 1–86	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1N9R Crystal structure of a heptameric ring complex of yeast SmF in spacegroup P4122 Deposited 2002-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–86（86 aa） Chain B 1–86（86 aa） Chain C 1–86（86 aa） Chain D 1–86（86 aa） Chain E 1–86（86 aa） Chain F 1–86（86 aa） Chain G 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；289 K；PEG 3350, sodium acetate, pH 8.5, VAPOR DIFFUSION, SITTING DROP at 289K	Resolution 2.80 Å R-free 0.268
1N9R Crystal structure of a heptameric ring complex of yeast SmF in spacegroup P4122 Deposited 2002-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–86（86 aa） Chain B 1–86（86 aa） Chain C 1–86（86 aa） Chain D 1–86（86 aa） Chain E 1–86（86 aa） Chain F 1–86（86 aa） Chain G 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；289 K；PEG 3350, sodium acetate, pH 8.5, VAPOR DIFFUSION, SITTING DROP at 289K	Resolution 2.80 Å R-free 0.268
1N9S Crystal structure of yeast SmF in spacegroup P43212 Deposited 2002-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–86（86 aa） Chain B 1–86（86 aa） Chain C 1–86（86 aa） Chain D 1–86（86 aa） Chain E 1–86（86 aa） Chain F 1–86（86 aa） Chain G 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；289 K；Tris, PEG 3350, sodium acetate, pH 8.5, VAPOR DIFFUSION, SITTING DROP at 289K	Resolution 3.50 Å R-free 0.297
1N9S Crystal structure of yeast SmF in spacegroup P43212 Deposited 2002-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain H 1–86（86 aa） Chain I 1–86（86 aa） Chain J 1–86（86 aa） Chain K 1–86（86 aa） Chain L 1–86（86 aa） Chain M 1–86（86 aa） Chain N 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；289 K；Tris, PEG 3350, sodium acetate, pH 8.5, VAPOR DIFFUSION, SITTING DROP at 289K	Resolution 3.50 Å R-free 0.297
1N9S Crystal structure of yeast SmF in spacegroup P43212 Deposited 2002-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–86（86 aa） Chain B 1–86（86 aa） Chain C 1–86（86 aa） Chain D 1–86（86 aa） Chain E 1–86（86 aa） Chain F 1–86（86 aa） Chain G 1–86（86 aa） Chain H 1–86（86 aa） Chain I 1–86（86 aa） Chain J 1–86（86 aa） Chain K 1–86（86 aa） Chain L 1–86（86 aa） Chain M 1–86（86 aa） Chain N 1–86（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；289 K；Tris, PEG 3350, sodium acetate, pH 8.5, VAPOR DIFFUSION, SITTING DROP at 289K	Resolution 3.50 Å R-free 0.297
3JCM Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 34-meric	Chain W 1–86（86 aa） Chain Z 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 M7M N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5GAM Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: Dodecameric	Chain f 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAN The overall structure of the yeast spliceosomal U4/U6.U5 tri-snRNP at 3.7 Angstrom Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 35-meric	Chain f 1–86（86 aa） Chain q 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAO Head region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: 11-meric	Chain q 1–86（86 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 4.20 Å
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain h 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain h 1–86（86 aa） Chain w 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain f 1–86（86 aa） Chain q 1–86（86 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain f 1–86（86 aa） Chain q 1–86（86 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain f 1–86（86 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5MPS Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 25 PDB declaration: 30-meric	Chain f 1–86（86 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 3.85 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain f 1–86（86 aa） Chain q 1–86（86 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain f 1–86（86 aa） Chain q 1–86（86 aa） Chain x 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain H 1–86（86 aa） Chain h 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain c 1–86（86 aa） Chain j 1–86（86 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain c 1–86（86 aa） Chain j 1–86（86 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain U 1–86（86 aa） Chain f 1–86（86 aa） Chain j 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain f 1–86（86 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain U 1–86（86 aa） Chain f 1–86（86 aa） Chain j 1–86（86 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain b 1–86（86 aa） Chain m 1–86（86 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain f 1–86（86 aa） Chain q 1–86（86 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain h 1–86（86 aa） Chain w 1–86（86 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain h 1–86（86 aa） Chain w 1–86（86 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain h 1–86（86 aa） Chain w 1–86（86 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain h 1–86（86 aa） Chain w 1–86（86 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain P 1–86（86 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain P 1–86（86 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain P 1–86（86 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7B9V Yeast C complex spliceosome at 2.8 Angstrom resolution with Prp18/Slu7 bound Deposited 2020-12-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 45 PDB declaration: 50-meric	Chain f 1–86（86 aa） Chain q 1–86（86 aa）	Not recorded	MG MAGNESIUM ION × 6 K POTASSIUM ION × 1 KGN D-chiro inositol hexakisphosphate × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain x 1–86（86 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain f 1–86（86 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain f 1–86（86 aa） Chain x 1–86（86 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain P 1–86（86 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain f 1–86（86 aa） Chain q 1–86（86 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

35 other PDB entries and 38 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RUXF_YEAST
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain f； PDBConstruct 1–86； UniProt 1–86 Author chain x； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P40204

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain g； UniProt 1–77 Chain y； UniProt 1–77	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3JCM Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 34-meric	Chain X 1–77（77 aa） Chain a 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 M7M N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5GAM Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: Dodecameric	Chain g 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAN The overall structure of the yeast spliceosomal U4/U6.U5 tri-snRNP at 3.7 Angstrom Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 35-meric	Chain g 1–77（77 aa） Chain r 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAO Head region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: 11-meric	Chain r 1–77（77 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 4.20 Å
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain j 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain j 1–77（77 aa） Chain x 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain g 1–77（77 aa） Chain r 1–77（77 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain g 1–77（77 aa） Chain r 1–77（77 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain g 1–77（77 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5MPS Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 25 PDB declaration: 30-meric	Chain g 1–77（77 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 3.85 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain g 1–77（77 aa） Chain r 1–77（77 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain g 1–77（77 aa） Chain r 1–77（77 aa） Chain y 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain K 1–77（77 aa） Chain j 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain d 1–77（77 aa） Chain k 1–77（77 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain d 1–77（77 aa） Chain k 1–77（77 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain V 1–77（77 aa） Chain g 1–77（77 aa） Chain k 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain g 1–77（77 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain V 1–77（77 aa） Chain g 1–77（77 aa） Chain k 1–77（77 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain d 1–77（77 aa） Chain n 1–77（77 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain g 1–77（77 aa） Chain r 1–77（77 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain j 1–77（77 aa） Chain x 1–77（77 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain j 1–77（77 aa） Chain x 1–77（77 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain j 1–77（77 aa） Chain x 1–77（77 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain j 1–77（77 aa） Chain x 1–77（77 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain Q 1–77（77 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain Q 1–77（77 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain Q 1–77（77 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7B9V Yeast C complex spliceosome at 2.8 Angstrom resolution with Prp18/Slu7 bound Deposited 2020-12-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 45 PDB declaration: 50-meric	Chain g 1–77（77 aa） Chain r 1–77（77 aa）	Not recorded	MG MAGNESIUM ION × 6 K POTASSIUM ION × 1 KGN D-chiro inositol hexakisphosphate × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7DCO Cryo-EM structure of the activated spliceosome (Bact complex) at an atomic resolution of 2.5 angstrom Deposited 2020-10-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 56-meric	Chain g 1–77（77 aa） Chain k 1–77（77 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 CA CALCIUM ION × 1 ZN ZINC ION × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain y 1–77（77 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain g 1–77（77 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain g 1–77（77 aa） Chain y 1–77（77 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain Q 1–77（77 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain g 1–77（77 aa） Chain r 1–77（77 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

34 other PDB entries and 34 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RUXG_YEAST
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain g； PDBConstruct 1–77； UniProt 1–77 Author chain y； PDBConstruct 1–77； UniProt 1–77

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt Q02260

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain h； UniProt 1–146 Chain t； UniProt 1–146	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D2 × 2 （Q06217） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3JCM Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 34-meric	Chain P 1–146（146 aa） Chain T 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 M7M N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5GAM Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: Dodecameric	Chain h 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAN The overall structure of the yeast spliceosomal U4/U6.U5 tri-snRNP at 3.7 Angstrom Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 35-meric	Chain h 1–146（146 aa） Chain l 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAO Head region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: 11-meric	Chain l 1–146（146 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 4.20 Å
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain m 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain m 1–146（146 aa） Chain z 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain h 1–146（146 aa） Chain l 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain h 1–146（146 aa） Chain l 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain h 1–146（146 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5MPS Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 25 PDB declaration: 30-meric	Chain h 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 3.85 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain h 1–146（146 aa） Chain l 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain h 1–146（146 aa） Chain l 1–146（146 aa） Chain t 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain V 1–146（146 aa） Chain m 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain f 1–146（146 aa） Chain m 1–146（146 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain f 1–146（146 aa） Chain m 1–146（146 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain Q 1–146（146 aa） Chain b 1–146（146 aa） Chain m 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain b 1–146（146 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain Q 1–146（146 aa） Chain b 1–146（146 aa） Chain m 1–146（146 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain h 1–146（146 aa） Chain p 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain h 1–146（146 aa） Chain l 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain m 1–146（146 aa） Chain z 1–146（146 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain m 1–146（146 aa） Chain z 1–146（146 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain m 1–146（146 aa） Chain z 1–146（146 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain m 1–146（146 aa） Chain z 1–146（146 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain L 1–146（146 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain L 1–146（146 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain L 1–146（146 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7B9V Yeast C complex spliceosome at 2.8 Angstrom resolution with Prp18/Slu7 bound Deposited 2020-12-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 45 PDB declaration: 50-meric	Chain h 1–146（146 aa） Chain l 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 6 K POTASSIUM ION × 1 KGN D-chiro inositol hexakisphosphate × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain t 1–146（146 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain h 1–146（146 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain h 1–146（146 aa） Chain t 1–146（146 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain L 1–146（146 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain h 1–146（146 aa） Chain l 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

33 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SMD1_YEAST
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain h； PDBConstruct 1–146； UniProt 1–146 Author chain t； PDBConstruct 1–146； UniProt 1–146

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt Q06217

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 35 RNA 3 PDB declaration: 38-meric（38） Consistent with all polymer counts	Chain i； UniProt 1–110 Chain u； UniProt 1–110	Not recorded	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA × 1 U2 snRNA × 1 ;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ; × 1 （P32605） ;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ; × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） Pre-mRNA-processing factor 39 × 1 （P39682） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Protein LUC7,Protein LUC7,Protein LUC7 × 1 （Q07508） Yeast UBC4 pre-mRNA (mutant) × 1 U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） U2 snRNP component HSH155 × 1 （P49955） Pre-mRNA-splicing factor RSE1 × 1 （Q04693） Cold sensitive U2 snRNA suppressor 1 × 1 （Q02554） Protein HSH49 × 1 （Q99181） Pre-mRNA-splicing factor RDS3 × 1 （Q06835） Pre-mRNA-splicing factor PRP9 × 1 （P19736） Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11 × 1 （Q07350） Pre-mRNA-splicing factor PRP21 × 1 （P32524） ;U2 small nuclear ribonucleoprotein A' ; × 1 （Q08963） Unknown × 1 ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P40567） RDS3 complex subunit 10 × 1 （P0C074） Small nuclear ribonucleoprotein-associated protein B × 2 （P40018） Small nuclear ribonucleoprotein Sm D3 × 2 （P43321） Small nuclear ribonucleoprotein E × 2 （Q12330） Small nuclear ribonucleoprotein F × 2 （P54999） Small nuclear ribonucleoprotein G × 2 （P40204） Small nuclear ribonucleoprotein Sm D1 × 2 （Q02260） ZN ZINC ION × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.9 cryo-EM vitrification conditions：Cryogen ETHANE；Grids were blotted for 2-3.5 s and vitrified by plunging into liquid ethane with a FEI Vitrobot Mark III operated at 4 degree Celsius and 100% humidity.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6G90	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3JCM Cryo-EM structure of the spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 30 PDB declaration: 34-meric	Chain Q 1–110（110 aa） Chain U 1–110（110 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 M7M N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
5GAM Foot region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: Dodecameric	Chain j 1–110（110 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAN The overall structure of the yeast spliceosomal U4/U6.U5 tri-snRNP at 3.7 Angstrom Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 35-meric	Chain j 1–110（110 aa） Chain m 1–110（110 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 3.70 Å
5GAO Head region of the yeast spliceosomal U4/U6.U5 tri-snRNP Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 10 PDB declaration: 11-meric	Chain m 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9	Resolution 4.20 Å
5GM6 Cryo-EM structure of the activated spliceosome (Bact complex) at 3.5 angstrom resolution Deposited 2016-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain g 15–108（94 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 5 ZN ZINC ION × 13 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5GMK Cryo-EM structure of the Catalytic Step I spliceosome (C complex) at 3.4 angstrom resolution Deposited 2016-07-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 45-meric	Chain e 1–110（110 aa） Chain g 1–110（110 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8；The CEB buffer (10 mM Tris-HCl, pH 8.0, 75 mM NaCl, 1 mM Mg(OAc)2, 1 mM imidazole, 0.01% NP40, 1 mM TCEP, 0.5 mM EGTA) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5LJ3 Structure of the core of the yeast spliceosome immediately after branching Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 38-meric	Chain j 1–110（110 aa） Chain m 1–110（110 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 3.80 Å
5LJ5 Overall structure of the yeast spliceosome immediately after branching. Deposited 2016-07-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 45-meric	Chain j 1–110（110 aa） Chain m 1–110（110 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 7 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；3 microlitres sample were applied to the grid, left for 30 seconds and then blotted for 2.5-3.0 seconds before plunging.	Resolution 10.00 Å
5LQW yeast activated spliceosome Deposited 2016-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 27 PDB declaration: 31-meric	Chain j 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
5MPS Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 25 PDB declaration: 30-meric	Chain j 1–110（110 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 3.85 Å
5MQ0 Structure of a spliceosome remodeled for exon ligation Deposited 2016-12-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 46-meric	Chain j 1–110（110 aa） Chain m 1–110（110 aa）	Not recorded	MG MAGNESIUM ION × 3 K POTASSIUM ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；NP-40 is also called IGEPAL CA-630 cryo-EM vitrification conditions Cryogen ETHANE；3.5 microlitres sample were applied to the grid, left for 25 seconds and then blotted for 3.0-3.5 seconds before plunging.	Resolution 4.17 Å
5NRL Structure of a pre-catalytic spliceosome Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain i 1–110（110 aa） Chain m 1–110（110 aa） Chain u 1–110（110 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；Buffer pH: HEPES, 7.9; EDTA, 8.0 cryo-EM vitrification conditions Cryogen ETHANE；Grids were glow-discharged for 15 s before deposition of 3 microliter sample (~1.5 mg mL-1), and subsequently incubated for 2-3.5 s before blotting and vitrification by plunging into liquid ethane with a Vitrobot Mark III (FEI) operated at 4 degrees Celsius and 100% humidity.	Resolution 7.20 Å
5WSG Cryo-EM structure of the Catalytic Step II spliceosome (C* complex) at 4.0 angstrom resolution Deposited 2016-12-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 45-meric	Chain W 1–110（110 aa） Chain g 1–110（110 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10mM Tris-HCl, pH 8.0, 75mM NaCl, 1mM Mg(OAc)2, 1mM imidazole, 0.01% NP40, 1mM TCEP, 0.5mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5Y88 Cryo-EM structure of the intron-lariat spliceosome ready for disassembly from S.cerevisiae at 3.5 angstrom Deposited 2017-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 44-meric	Chain g 1–110（110 aa） Chain n 1–110（110 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
5YLZ Cryo-EM Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae at 3.6 angstrom Deposited 2017-10-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 43-meric	Chain g 1–110（110 aa） Chain n 1–110（110 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
5ZWM Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.4~4.6 angstrom (tri-snRNP and U2 snRNP Part) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 57-meric	Chain R 1–110（110 aa） Chain c 1–110（110 aa） Chain n 1–110（110 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWN Cryo-EM structure of the yeast pre-B complex at an average resolution of 3.3 angstrom (Part II: U1 snRNP region) Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain c 1–110（110 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
5ZWO Cryo-EM structure of the yeast B complex at average resolution of 3.9 angstrom Deposited 2018-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 60-meric	Chain R 1–110（110 aa） Chain c 1–110（110 aa） Chain n 1–110（110 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6BK8 S. cerevisiae spliceosomal post-catalytic P complex Deposited 2017-11-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 46-meric	Chain a 1–110（110 aa） Chain q 1–110（110 aa）	Not recorded	MG MAGNESIUM ION × 5 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6EXN Post-catalytic P complex spliceosome with 3' splice site docked Deposited 2017-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 40-meric	Chain j 1–110（110 aa） Chain m 1–110（110 aa）	Not recorded	MG MAGNESIUM ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE；3 uL sample was applied to the grid, left for 30s, then blotted for 3s and immediately plunged into liquid ethane.	Resolution 3.70 Å
6J6G Cryo-EM structure of the yeast B*-a2 complex at an average resolution of 3.2 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain e 1–110（110 aa） Chain g 1–110（110 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6J6H Cryo-EM structure of the yeast B*-a1 complex at an average resolution of 3.6 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain e 1–110（110 aa） Chain g 1–110（110 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6J6N Cryo-EM structure of the yeast B*-b1 complex at an average resolution of 3.86 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 37 PDB declaration: 41-meric	Chain e 1–110（110 aa） Chain g 1–110（110 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
6J6Q Cryo-EM structure of the yeast B*-b2 complex at an average resolution of 3.7 angstrom Deposited 2019-01-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 42-meric	Chain e 1–110（110 aa） Chain g 1–110（110 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 6 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6N7P S. cerevisiae spliceosomal E complex (UBC4) Deposited 2018-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain M 1–110（110 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6N7R Saccharomyces cerevisiae spliceosomal E complex (ACT1) Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain M 1–110（110 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6N7X S. cerevisiae U1 snRNP Deposited 2018-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 15 PDB declaration: hexadecameric	Chain M 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7B9V Yeast C complex spliceosome at 2.8 Angstrom resolution with Prp18/Slu7 bound Deposited 2020-12-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 45 PDB declaration: 50-meric	Chain j 1–110（110 aa） Chain m 1–110（110 aa）	Not recorded	MG MAGNESIUM ION × 6 K POTASSIUM ION × 1 KGN D-chiro inositol hexakisphosphate × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7OQB The U2 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain u 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
7OQC The U1 part of Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: octadecameric	Chain i 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7OQE Saccharomyces cerevisiae spliceosomal pre-A complex (delta BS-A ACT1) Deposited 2021-06-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 39-meric	Chain i 1–110（110 aa） Chain u 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8W2O Yeast U1 snRNP with humanized U1C Zinc-Finger domain Deposited 2024-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain M 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9；20 mM Hepes, pH7.9, 120 mM KCl, 2 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE；The grids were obtained with the chamber at 100% humidity, 2.5 s blotting time, -6 blotting force and 15 s wait time and flash-frozen into liquid ethane with a Vitrobot Mark IV (Thermo Fisher Scientific)	Resolution 3.49 Å
9DTR Structure of the yeast post-catalytic P complex spliceosome at 2.3 Angstrom resolution Deposited 2024-10-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 42 PDB declaration: 47-meric	Chain j 1–110（110 aa） Chain m 1–110（110 aa）	Not recorded	MG MAGNESIUM ION × 2 K POTASSIUM ION × 4 IHP INOSITOL HEXAKISPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å

33 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SMD2_YEAST
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain i； PDBConstruct 1–110； UniProt 1–110 Author chain u； PDBConstruct 1–110； UniProt 1–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6g90
Deposition date deposition_date	2018-04-10
Structure title title	Prespliceosome structure provides insight into spliceosome assembly and regulation (map A2)
Keywords keywords	Spliceosome, A complex, RNA processing, RNA-protein complex, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	88.57 Å
Radius of gyration Rg (electron density) rg_electron	89.06 Å
Forward intensity I(0) i0	14840300000.00
Molecular weight molecular_weight	934780.0 kDa
Excluded volume excluded_volume	1126500 Å³
Envelope volume envelope_volume	2087500 Å³
Hydration-shell volume shell_volume	191000 Å³
Envelope diameter envelope_diameter	281.5 Å
Shell Rg shell_rg	91.11 Å
Envelope Rg envelope_rg	84.31 Å
Shape Rg shape_rg	89.08 Å
Total Rg total_rg	89.02 Å
Total atoms total_atoms	65050
Residues n_residues	7479
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	311.2 Å
Rg (real space) rg_real	92.36 Å
Rg uncertainty (real space) rg_real_error	2.17 Å
I(0) (real space) i0_real	1.4900e+10
I(0) uncertainty (real space) i0_real_error	3.4030e+08
Rg (reciprocal space) rg_reciprocal	88.99 Å
I(0) (reciprocal space) i0_reciprocal	14860000000.0000
Solution quality estimate total_estimate	0.8762
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	138.3 Å
Skewness Skewness skewness	0.283
Kurtosis Kurtosis kurtosis	-0.312
Angular range angular_range	— – 0.0900 Å⁻¹
Current regularization parameter α current_alpha	0.9897
Highest regularization parameter α highest_alpha	1109000000.0000
Real-space data points n_real_points	19
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.790; Stabil: 0.859; Sysdev: 1.000; Positv: 1.000; Valcen: 0.976; Smooth: 0.498

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Description description	U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA,U1 snRNA
Molecular weight formula_weight	126116.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	1
Atom count atom_count	65050

AUACUUACCUUAAGAUAUCAGAGGAGAUCAAGAAGUCCUACUGAUCAAACAUGCGCUUCCAAUAGUAGAAGGACGUUAAGCAUUUAUCAUUGAACUAUAAUUGUUCAUUGAAGUCAUUGAUGCAAACUCCUUGGUCACACACACAUACGGCGCGGAAGGCGUGUUUGCUGACGUUUCCAUUCCCUUGUUUCAAUCAUUGGUUAAUCCCUUGAUUCCUUUGGGGAUUUUUGGGUUAAACUGAUUUUUGGGGCCCUUUGUUUCUUCUGCCUGGAGAAGUUUGACACCAAAUUCAAAUUGGUGUUAGGGGAGCUGGGGCCUUUCAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNUUUUGGAAGGUCUUGGUCGGGUGGAUCUUAUAAUUUUUGAUUUAUUUU

Entity 2 Entity 2 polymer

Description description	U2 snRNA
Molecular weight formula_weight	45762.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

AAGUGUAGUAUCUGUUCUUUUCAGUGUAACAACUGAAAUGACCUAGGCUCAUACACAUUUUUUGGCAGGACGGGAAGAGGAGACGUCGCGACCCUCGCAGAGUCGUUCUUGACUUGGUCGCUUGAUGUUUCUUCUUCCCGUUC

Entity 3 Entity 3 polymer

Description description	;U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein A ;
Molecular weight formula_weight	33754.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSALYFQNLPSRPANKENYTRLLLKHINPNNKYAINPSLPLPHNKLQISSQPLMLLDDQMGLLEVSISRSSKMTNQAFLTFVTQEEADRFLEKYTTTALKVQGRKVRMGKARTNSLLGXXXXXQKKKGNDETYXXXXXXXXXXXXXXXKLRSDDICAKKFRLKRQIRRLKHKLRSRKVEEAEIDRIVKEFETRRLENMKSQQENLKQSQKPLKRAKVSNTMENPPNKVLLIQNLPSGTTEQLLSQILGNEALVEIRLVSVRNLAFVEYETVADATKIKNQLGSTYKLQNNDVTIGFAK

Entity 4 Entity 4 polymer

Description description	;U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog,U1 small nuclear ribonucleoprotein 70 kDa homolog ;
Molecular weight formula_weight	33445.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MNYNLSKYPDDVSRLFKPRPPLSYKRPTDYPYAKRQTNPNITGVANLLSTSLKHYMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQNWNPNVDPHIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICIVDIERGRTVKYFKPRRLGGGLGGRGYSNRDSRLPGRFASASTSNPAERNYAPRLPRRETSSSAYSADRYGSSTLDARYRGNRPLLSAATPTAAVTSVYKSRNSRTRESQPAPKEAPDY

Entity 5 Entity 5 polymer

Description description	U1 small nuclear ribonucleoprotein C
Molecular weight formula_weight	27106.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQTSRSRDETCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVDILQTTIKESKKRMHSDGIRKPSSANGYKRRRYGN

Entity 6 Entity 6 polymer

Description description	Pre-mRNA-processing factor 39
Molecular weight formula_weight	74834.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MPDETNFTIEDIEPRPDALRGLDTQFLQDNTALVQAYRGLDWSDISSLTQMVDVIEQTVVKYGNPNDSIKLALETILWQILRKYPLLFGFWKRFATIEYQLFGLKKSIAVLATSVKWFPTSLELWCDYLNVLCVNNPNETDFIRNNFEIAKDLIGKQFLSHPFWDKFIEFEVGQKNWHNVQRIYEYIIEVPLHQYARFFTSYKKFLNEKNLKTTRNIDIVLRKTQTTVNEIWQFESKIKQPFFNLGQVLNDDLENWSRYLKFVTDPSKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWLTKKNISDEVVVDIYQKANTFLPLDFKTLRYDFLRFLKRKYRSNNTLFNNIFNETVSRYLKIWPNDILLMTEYLCMLKRHSFKNSLDQSPKEILEKQTSFTKILETSITNYINNQIDAKVHLQTLINDKNLSIVVVELIKTTWLVLKNNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKSNVNFTKLNKFIRELGVEIYLPTTVMNDILTDYKTFYLTHSNIVTYESSIIDSNTFDPILYPELKMSNPKYDPVLNTTANVDWHKKTEWKEAGHIGITTERPQISNSIIECNSGTLIQKPISLPNFRNLEKINQVKINDLYTEEFLKEGK

Entity 7 Entity 7 polymer

Description description	U1 small nuclear ribonucleoprotein component PRP42
Molecular weight formula_weight	65222.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDKYTALIHDENFSTLTLNVSRYPKSLAYWEKLLNYIVKASAPICKSTEPQLLKLIRCTYSSMLNEFPYLENYYIDFALLEYKLGNVSMSHKIFQRGLQAFNQRSLLLWTSYLKFCNNVISHQKQLFKKYETAEEYVGLHFFSGEFWDLYLEQISSRCTSSKKYWNVLRKILEIPLHSFSKFYALWLQRIDDIMDLKQLSQLTSKDELLKKLKIDINYSGRKGPYLQDAKKKLKKITKEMYMVVQYQVLEIYSIFESKIYINYYTSPETLVSSDEIETWIKYLDYTITLQTDSLTHLNFQRALLPLAHYDLVWIKYSKWLINSKNDLLGAKNVLLMGLKFSLKKTEIIKLLYSVICKLNEYVLLRNLLEKIESSYSDNVENVDDFEIFWDYLQFKTFCQNSLYSSRYSDSQSNGLLNKELFDKVWKRLSCKEKKSGQEILLNNLVQFYSKDTVEFVEKNIFQKIIEFGWEYYLQNGMFWNCYCRLIYFDTSRSYLDKRQYIVRKIWPQIDKKFAQSVLPSLTEFCESYFPEEMDTLEEMFTEEP

Entity 8 Entity 8 polymer

Description description	Protein NAM8
Molecular weight formula_weight	57010.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSYKQTTYYPSRGNLVRNDSSPYTNTISSETNNSSTSVLSLQGASNVSLGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPSSTHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSAKQTALLQQAMLSNSLQVQQQQPGLQQPNYGYIPSSTCEAPVLPDNNVSSTMLPGCQILNYSNPYANANGLGSNNFSFYSNNNATNTQATSLLADTSSMDLSGTGGQQVIMQGSEAVVNSTNAMLNRLEQGSNGFMFA

Entity 9 Entity 9 polymer

Description description	56 kDa U1 small nuclear ribonucleoprotein component
Molecular weight formula_weight	56575.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MRPRRRGLAYHHTKPKGQLSQGHYPTTSNDGQRRKVGNSEAFQSFDIWKNLDRIRSTKKNAGQFIKGSLLILPMRTEDKQQFDECMDELHKYISKDILRCYPQKEQKDEGMLFYIVLKDFNILDSCFVLSVLLAFQKRLWMAPSEKSYFRVPKNINLTGSFYLPKNIETGRGHIITSYRREQPSSSIVEVGFNVVPDFQQFQVKACHVSKFMNELSNFFSQVEFGKCEANVINYFKREYNRTYSQISLALYELPLIGDGLFDIKSYISKTRPIIETSKAQMIKHISEMKAYNEISGLQGDQFPRQQRPLSNSPSSNSISSSQTIEAGATSYQTQPQRHAVNKPSNVLNSSNRHSGPKTFEDGRYSEGNKPGFMTQDEIKQHCIGTIKASMDAVKKKSSYQILKTYVRCPRQNYIDIVYQNLNDLRSKTNCNIVVLNLNNLHESQMWLESLNTTNYTIFAQAPHPSTIRVISIGGVGEYIVKALELILNILEH

Entity 10 Entity 10 polymer

Description description	Protein LUC7,Protein LUC7,Protein LUC7
Molecular weight formula_weight	28504.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSTMSTPAAEQRKLVEQLMGRDFSFRHNRYSHQKRDLGLHDPKICKSYLVGECPYDLFQGTKQSLGKCPQMHLTKHKIQYERVEKQGKTFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQEIDSLIRADEVSMGMLQSVKLQELISKRKEVAKRVRNITENVGQSAQQKLQVCEVCGAYLSRLDTDRRLADHFLGKIHLGYVKMREDYDRLMKNNRTTNASKTATTLPGRRFV

Entity 11 Entity 11 polymer

Description description	Yeast UBC4 pre-mRNA (mutant)
Molecular weight formula_weight	12045.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	I

AGGUAUGUCUAACUUCUCUUAUUUACAAACAAAAUCAA

Entity 12 Entity 12 polymer

Description description	U1 small nuclear ribonucleoprotein component SNU71
Molecular weight formula_weight	71484.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDIVFVSPQLYLSSQEGWKSDSAKSGFIPILKNDLQRFQDSLKHIVDARNSLSETLLNSNDDGSIHNSDQNTGLNKDKEASIADNNSANKCATSSSRYQELKQFLPISLDQQIHTVSLQGVSSSFSRGQIESLLDHCLNLALTETQSNSALKVEAWSSFSSFLDTQDIFIRFSKVDEDEAFVNTLNYCKALFAFIRKLHEDFKIELHLDLNTKEYVEDRTGTIPSVKPEKASEFYSVFKNIEDQTDERNSKKEQLDDSSTQYKVDTNTLSDLPSDALDQLCKDIIEFRTKVVSIEKEKKMKSTYEESRRQRHQMQKVFDQIRKNHSGAKGSANTEEEDTNMEDEDEEDDTEDDLALEKRKEERDLEESNRRYEDMLHQLHSNTEPKIKSIRADIMSAENYEEHLEKNRSLYLKELLHLANDVHYDHHRSFKEQEERRDEEDRAKNGNAKELAPIQLSDGKAISAGKAAAITLPEGTVKSENYNADKNVSESSEHVKIKFDFKKAIDHSVESSSEDEGYRESELPPTKPSERSAAEDRLPFTADELNIRLTNLKESRYVDELVREFLGVYEDELVEYILENIRVNQSKQALLNELRETFDEDGETIADRLWSRKEFRLGT

Entity 13 Entity 13 polymer

Description description	U2 snRNP component HSH155
Molecular weight formula_weight	110166.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSHPIQFVNANNSDKSHQLGGQYSIPQDLRENLQKEAARIGENEKDVLQEKMETRTVQNREDSYHKRRFDMKFEPDSDTQTVTSSENTQDAVVPRKRKSRWDVKGYEPPDESSTAVKENSDSALVNVEGIHDLMFFKPSDHKYFADVISKKPIDELNKDEKKERTLSMLLLKIKNGNTASRRTSMRILTDKAVTFGPEMIFNRLLPILLDRSLEDQERHLMIKTIDRVLYQLGDLTKPYVHKILVVAAPLLIDEDPMVRSTGQEIITNLSTVAGLKTILTVMRPDIENEDEYVRNVTSRAAAVVAKALGVNQLLPFINAACHSRKSWKARHTGIKIVQQIGILLGIGVLNHLTGLMSCIKDCLMDDHVPVRIVTAHTLSTLAENSYPYGIEVFNVVLEPLWKGIRSHRGKVLSSFLKAVGSMIPLMDPEYAGYYTTEAMRIIRREFDSPDDEMKKTILLVLQKCSAVESITPKFLREEIAPEFFQKFWVRRVALDRPLNKVVTYTTVTLAKKLGCSYTIDKLLTPLRDEAEPFRTMAVHAVTRTVNLLGTADLDERLETRLIDALLIAFQEQTNSDSIIFKGFGAVTVSLDIRMKPFLAPIVSTILNHLKHKTPLVRQHAADLCAILIPVIKNCHEFEMLNKLNIILYESLGEVYPEVLGSIINAMYCITSVMDLDKLQPPINQILPTLTPILRNKHRKVEVNTIKFVGLIGKLAPTYAPPKEWMRICFELLELLKSTNKEIRRSANATFGFIAEAIGPHDVLVALLNNLKVQERQLRVCTAVAIGIVAKVCGPYNVLPVIMNEYTTPETNVQNGVLKAMSFMFEYIGNMSKDYIYFITPLLEDALTDRDLVHRQTASNVITHLALNCSGTGHEDAFIHLMNLLIPNIFETSPHAIMRILEGLEALSQALGPGLFMNYIWAGLFHPAKNVRKAFWRVYNNMYVMYQDAMVPFYPVTPDNNEEYIEELDLVL

Entity 14 Entity 14 polymer

Description description	Pre-mRNA-splicing factor RSE1
Molecular weight formula_weight	153956.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MWGGGKMAVVSLSPHTAKMRKLFGQASTTMAYDGLKREAERRTRSDHNITMVAKDDELYLYHLTLKKQTNFVHSCIGHFVDLEAGSKREQSQLCVATETHLELYDTADGELKLIAKFQNLFATITSMKSLDLPHSGSRAKASNWPTFLALTSDSGNLSIVQIIMHAGALRLKTLVNQPLTRTTLRRVSPISYMEIDPNGRCIILSSVEQNKLCFLVDYAQKLRISSPLEIIRPHMVTLDMAVVDVNFNNPCFVTLEIDNAATQLSVHLIFYVLELGLNHIVKKADYLVNPSANFVLSLPDLSRYNITTSLSDNNYDADYDTLFNPFVVIGFENHILVKDMNGFFSLKVEIPKRSITNSRHKNVTIISGIVQKLKNDFFVLLQSNHGDLFKLTVSPDTNDRNRPLVQLSYFDTIQNSHQLHIFKNGYLFALSEMNNNFLFQFEKLGVEKNDFSNVLTSKDPNKSLVFEPSIKLQNLSILSQQLNLNPSIKSQIVSDSPLSIATKHFTNNKIITLTNAVNYSNLISTSLPPNATKLWLIPDPATTGDNNTLLFITFPKKTMILQIDNESMEELTPDEATRSAFKLSQDTTIHTCLMGSHSIIQVCTAELRHIVPTGKSRYSNKLTWVPPAGIRIVCATSSKTQLIISLSNYELVYFKIDVSSDSLIELTTHPELDTMPSKVAIVQDTQHADLLAIADNEGMIKIMSLKDQKEDFLTVISLQLVSEKISDMIMVRDSSIGQLNLHVGLENGVYMKFHIGDVDGSFTDIKRRFLGLKPVSLSYLREISVSLNNEEEEEEEEDDDDEKEEEEINSSGAKWMSCVVCHSSSTWVSYTWKNVWTIRQLKDQNMLSCSKFVNADVAINGVCSISSSGRLNIGRVSNFPTLDNWFHVHESSVNKQENGGGDESNEEEEDEMEEEMEMLQISTFRPRTILSFPNNPKSILFIDNHSGKKQCRISLQIDGECLKFGSSDHLYKILDDIDCVSAAIIDFTRQADHLIICAGDKRLLTYKILVNKDKLSFDIELLHQTEIISPIHAMLKFKNFLLTAMGSTIVLYGLGKKQLLRRSVTQTPVSITKIVSMHQWNYERLAVGDIHESVTLFIWDPAGNVFIPYVDDSVKRHVTVLKFLDEATVIGADRYGNAWTLRSPPECEKIMSNHDPSELSNGAIKYPLDVITLQQKLPNTYDCKFKFQLLNHFFVNDIITDFHILDSLSNSDRPGCIYMGLQGTVGCFIPLLSKGNVFMMGNIENIMAEADDTFYLDYESRKKNNNMRKEDDEEESGSVVLQGRHGIEDEIICEGSCSILGRDHQEYRSYYAPVRKVIDGDLCENFLRLSLNEQEFLAKNLKSVQVEDIIQTINEVRTNYM

Entity 15 Entity 15 polymer

Description description	Cold sensitive U2 snRNA suppressor 1
Molecular weight formula_weight	50210.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MARTKSRKRSGNNQNKNASVVNNKAEIAAMIDARRLEQKKKGGVTNSKGKTNKVVDAKLEKEFKDVLQRFQVQENDTPKEITKDEKNNHVVIVEKNPVMNRKHTAEDELEDTPSDGIEEHLSARKRRKTEKPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPQSGLDGQDEKSLKEASRARVQPKMGALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQELRAIMNLPEGQLPPWCMKMKDIGLPTGYPDLKIAGLNWDITNLKGDVYGKIIPNHHSRSKKQGRNYFGALISFETPEFENSKEDTQANAENGRQDDKIDDEVEHKLDHFQEDISEVTSAEEKLERNEEESEKQLYTVL

Entity 16 Entity 16 polymer

Description description	Protein HSH49
Molecular weight formula_weight	24534.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MNYSADSGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGKLIREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFKENGKGNAKYGDDVDRLLNKEALKHNMLK

Entity 17 Entity 17 polymer

Description description	Pre-mRNA-splicing factor RDS3
Molecular weight formula_weight	12283.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MSRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKKKV

Entity 18 Entity 18 polymer

Description description	Pre-mRNA-splicing factor PRP9
Molecular weight formula_weight	63126.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIYKFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLEKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV

Entity 19 Entity 19 polymer

Description description	Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11,Pre-mRNA-splicing factor PRP11
Molecular weight formula_weight	29292.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQDEKDDQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKSSLGREGQTTHXXXXXXXXXXXXXXXXXXXXXXVCKIATVKNPKNGSVGLAIQVNYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFENIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQAEQEQADV

Entity 20 Entity 20 polymer

Description description	Pre-mRNA-splicing factor PRP21
Molecular weight formula_weight	33111.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MEPEDTQLKEDIKTTVNYIKQHGVEFENKLLEDERFSFIKKDDPLHEYYTKLMNEPTDTVSGEDNDRKSEREIARPPDFLFSQYDTGISRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFSIPEDTEIFEGSLDLEQMRLRRVQTGIKLFDSIKPTNEEEKIVSDQGKQKGGDSKGKKRKIRAVGETRLKKSKK

Entity 21 Entity 21 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	27232.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MKFTPSIVIDAPQYYVDHFNGKYNVDKCVILRDLQLETDSESMPSSLKHLTKPTHILDLTNNDLIMIPDLSRRDDIHTLLLGRNNIVEVDGRLLPMNVQNLTLSNNSIRRFEDLQRLRRAPRTLKNLTLIGNQVCHLANYREHVLRLVPHLETLDFQNVTAEERKSAMSFPRQADGDTLGPVNTAIRDNGSRDKTMEIMNLVVSKMTVERRNELKKQLAEATSLEEIARLEKLLSGGV

Entity 22 Entity 22 polymer

Description description	Unknown
Molecular weight formula_weight	4358.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 23 Entity 23 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	12850.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MVEPARKKQRIDRDTHHTVAEPVTEAKNTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL

Entity 24 Entity 24 polymer

Description description	RDS3 complex subunit 10
Molecular weight formula_weight	10045.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAEKQRQLKLQKIYKQKYIGLGDESTTREQWQRNVRNDTLNTLQGHSASLEYVSLSRGDLSIRDTRIHLLKSMSPGYKAYLREER

Entity 25 Entity 25 polymer

Description description	Small nuclear ribonucleoprotein-associated protein B
Molecular weight formula_weight	22427.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,s

MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK

Entity 26 Entity 26 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	11240.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,v

MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR

Entity 27 Entity 27 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10385.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,w

MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD

Entity 28 Entity 28 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9669.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,x

MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN

Entity 29 Entity 29 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8490.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,y

MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI

Entity 30 Entity 30 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	16296.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,t

MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL

Entity 31 Entity 31 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	12876.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,u

MSSQIIDRPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTPVE

Entity 32 Entity 32 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	9

▼

7. Fold Classification (SCOP + CATH) 14 domains

CATH v4.4 (14 domains)

Domain ID domain_id	6g90V01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	790 — Surp module

Domain ID domain_id	6g90V02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1320 —

Domain ID domain_id	6g90Y00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	6g90d00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90e00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90f00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90g00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90i00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90s00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90u00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90v00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90w00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90x00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6g90y00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

▶

8. Citations (1)

▶

Resolution resolution	4.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	153556

fit	/app/data/saxs_computation/g9/6g90/6g90.fit
pddf	/app/data/pr_computation/g9/6g90/6g90.pr.out
profile	/app/data/saxs_computation/g9/6g90/6g90.dat