6n7x

S. cerevisiae U1 snRNP

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U1 small nuclear ribonucleoprotein 70 kDa homolog

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU17_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–300； UniProt 1–300

U1 small nuclear ribonucleoprotein C

OrganismNot specified

UniProt Q05900

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU1C_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–231； UniProt 1–231

U1 small nuclear ribonucleoprotein A

OrganismNot specified

UniProt P32605

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU1A_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–298； UniProt 1–298

U1 small nuclear ribonucleoprotein component PRP42

OrganismNot specified

UniProt Q03776

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP42_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–544； UniProt 1–544

Pre-mRNA-processing factor 39

OrganismNot specified

UniProt P39682

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP39_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–629； UniProt 1–629

Protein NAM8

OrganismNot specified

UniProt Q00539

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NAM8_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–523； UniProt 1–523

56 kDa U1 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q03782

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNU56_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–492； UniProt 1–492

U1 small nuclear ribonucleoprotein component SNU71

OrganismNot specified

UniProt P53207

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNU71_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–620； UniProt 1–620

Small nuclear ribonucleoprotein-associated protein B

OrganismNot specified

UniProt P40018

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–196； UniProt 1–196

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt Q02260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–146； UniProt 1–146

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt Q06217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–110； UniProt 1–110

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P43321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain N； PDBConstruct 1–101； UniProt 1–101

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt Q12330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein F × 1 （P54999） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–94； UniProt 1–94

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P54999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein G × 1 （P40204） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain P； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P40204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 1	U1 small nuclear ribonucleoprotein 70 kDa homolog × 1 （Q00916） U1 small nuclear ribonucleoprotein C × 1 （Q05900） U1 small nuclear ribonucleoprotein A × 1 （P32605） U1 small nuclear ribonucleoprotein component PRP42 × 1 （Q03776） Pre-mRNA-processing factor 39 × 1 （P39682） Protein NAM8 × 1 （Q00539） 56 kDa U1 small nuclear ribonucleoprotein component × 1 （Q03782） U1 small nuclear ribonucleoprotein component SNU71 × 1 （P53207） Small nuclear ribonucleoprotein-associated protein B × 1 （P40018） Small nuclear ribonucleoprotein Sm D1 × 1 （Q02260） Small nuclear ribonucleoprotein Sm D2 × 1 （Q06217） Small nuclear ribonucleoprotein Sm D3 × 1 （P43321） Small nuclear ribonucleoprotein E × 1 （Q12330） Small nuclear ribonucleoprotein F × 1 （P54999） U1 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Q； PDBConstruct 1–77； UniProt 1–77

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6n7x
Deposition date deposition_date	2018-11-28
Structure title title	S. cerevisiae U1 snRNP
Keywords keywords	pre-mRNA splicing, U1 snRNP, alternative splicing, RNA BINDING PROTEIN-RNA complex; RNA BINDING PROTEIN/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6n7x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6n7x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6n7x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	58.06 Å
Rg (electron density)	58.18 Å
Total Rg	57.80 Å
Atom count	27183
Residues	3039
Excluded volume	460330 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6n7x__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	U1 small nuclear ribonucleoprotein 70 kDa homolog
Molecular weight formula_weight	34506.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	27183

MNYNLSKYPDDVSRLFKPRPPLSYKRPTDYPYAKRQTNPNITGVANLLSTSLKHYMEEFPEGSPNNHLQRYEDIKLSKIKNAQLLDRRLQNWNPNVDPHIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICIVDIERGRTVKYFKPRRLGGGLGGRGYSNRDSRLPGRFASASTSNPAERNYAPRLPRRETSSSAYSADRYGSSTLDARYRGNRPLLSAATPTAAVTSVYKSRNSRTRESQPAPKEAPDY

Entity 2 Entity 2 polymer

Description description	U1 small nuclear ribonucleoprotein C
Molecular weight formula_weight	27106.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQTSRSRDETCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVDILQTTIKESKKRMHSDGIRKPSSANGYKRRRYGN

Entity 3 Entity 3 polymer

Description description	U1 small nuclear ribonucleoprotein A
Molecular weight formula_weight	34438.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSALYFQNLPSRPANKENYTRLLLKHINPNNKYAINPSLPLPHNKLQISSQPLMLLDDQMGLLEVSISRSSKMTNQAFLTFVTQEEADRFLEKYTTTALKVQGRKVRMGKARTNSLLGLSIEMQKKKGNDETYNLDIKKVLKARKLKRKLRSDDICAKKFRLKRQIRRLKHKLRSRKVEEAEIDRIVKEFETRRLENMKSQQENLKQSQKPLKRAKVSNTMENPPNKVLLIQNLPSGTTEQLLSQILGNEALVEIRLVSVRNLAFVEYETVADATKIKNQLGSTYKLQNNDVTIGFAK

Entity 4 Entity 4 polymer

Description description	U1 small nuclear ribonucleoprotein component PRP42
Molecular weight formula_weight	65222.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MDKYTALIHDENFSTLTLNVSRYPKSLAYWEKLLNYIVKASAPICKSTEPQLLKLIRCTYSSMLNEFPYLENYYIDFALLEYKLGNVSMSHKIFQRGLQAFNQRSLLLWTSYLKFCNNVISHQKQLFKKYETAEEYVGLHFFSGEFWDLYLEQISSRCTSSKKYWNVLRKILEIPLHSFSKFYALWLQRIDDIMDLKQLSQLTSKDELLKKLKIDINYSGRKGPYLQDAKKKLKKITKEMYMVVQYQVLEIYSIFESKIYINYYTSPETLVSSDEIETWIKYLDYTITLQTDSLTHLNFQRALLPLAHYDLVWIKYSKWLINSKNDLLGAKNVLLMGLKFSLKKTEIIKLLYSVICKLNEYVLLRNLLEKIESSYSDNVENVDDFEIFWDYLQFKTFCQNSLYSSRYSDSQSNGLLNKELFDKVWKRLSCKEKKSGQEILLNNLVQFYSKDTVEFVEKNIFQKIIEFGWEYYLQNGMFWNCYCRLIYFDTSRSYLDKRQYIVRKIWPQIDKKFAQSVLPSLTEFCESYFPEEMDTLEEMFTEEP

Entity 5 Entity 5 polymer

Description description	Pre-mRNA-processing factor 39
Molecular weight formula_weight	74834.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MPDETNFTIEDIEPRPDALRGLDTQFLQDNTALVQAYRGLDWSDISSLTQMVDVIEQTVVKYGNPNDSIKLALETILWQILRKYPLLFGFWKRFATIEYQLFGLKKSIAVLATSVKWFPTSLELWCDYLNVLCVNNPNETDFIRNNFEIAKDLIGKQFLSHPFWDKFIEFEVGQKNWHNVQRIYEYIIEVPLHQYARFFTSYKKFLNEKNLKTTRNIDIVLRKTQTTVNEIWQFESKIKQPFFNLGQVLNDDLENWSRYLKFVTDPSKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWLTKKNISDEVVVDIYQKANTFLPLDFKTLRYDFLRFLKRKYRSNNTLFNNIFNETVSRYLKIWPNDILLMTEYLCMLKRHSFKNSLDQSPKEILEKQTSFTKILETSITNYINNQIDAKVHLQTLINDKNLSIVVVELIKTTWLVLKNNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKSNVNFTKLNKFIRELGVEIYLPTTVMNDILTDYKTFYLTHSNIVTYESSIIDSNTFDPILYPELKMSNPKYDPVLNTTANVDWHKKTEWKEAGHIGITTERPQISNSIIECNSGTLIQKPISLPNFRNLEKINQVKINDLYTEEFLKEGK

Entity 6 Entity 6 polymer

Description description	Protein NAM8
Molecular weight formula_weight	57010.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSYKQTTYYPSRGNLVRNDSSPYTNTISSETNNSSTSVLSLQGASNVSLGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPSSTHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSAKQTALLQQAMLSNSLQVQQQQPGLQQPNYGYIPSSTCEAPVLPDNNVSSTMLPGCQILNYSNPYANANGLGSNNFSFYSNNNATNTQATSLLADTSSMDLSGTGGQQVIMQGSEAVVNSTNAMLNRLEQGSNGFMFA

Entity 7 Entity 7 polymer

Description description	56 kDa U1 small nuclear ribonucleoprotein component
Molecular weight formula_weight	56575.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MRPRRRGLAYHHTKPKGQLSQGHYPTTSNDGQRRKVGNSEAFQSFDIWKNLDRIRSTKKNAGQFIKGSLLILPMRTEDKQQFDECMDELHKYISKDILRCYPQKEQKDEGMLFYIVLKDFNILDSCFVLSVLLAFQKRLWMAPSEKSYFRVPKNINLTGSFYLPKNIETGRGHIITSYRREQPSSSIVEVGFNVVPDFQQFQVKACHVSKFMNELSNFFSQVEFGKCEANVINYFKREYNRTYSQISLALYELPLIGDGLFDIKSYISKTRPIIETSKAQMIKHISEMKAYNEISGLQGDQFPRQQRPLSNSPSSNSISSSQTIEAGATSYQTQPQRHAVNKPSNVLNSSNRHSGPKTFEDGRYSEGNKPGFMTQDEIKQHCIGTIKASMDAVKKKSSYQILKTYVRCPRQNYIDIVYQNLNDLRSKTNCNIVVLNLNNLHESQMWLESLNTTNYTIFAQAPHPSTIRVISIGGVGEYIVKALELILNILEH

Entity 8 Entity 8 polymer

Description description	U1 small nuclear ribonucleoprotein component SNU71
Molecular weight formula_weight	71484.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MRDIVFVSPQLYLSSQEGWKSDSAKSGFIPILKNDLQRFQDSLKHIVDARNSLSETLLNSNDDGSIHNSDQNTGLNKDKEASIADNNSANKCATSSSRYQELKQFLPISLDQQIHTVSLQGVSSSFSRGQIESLLDHCLNLALTETQSNSALKVEAWSSFSSFLDTQDIFIRFSKVDEDEAFVNTLNYCKALFAFIRKLHEDFKIELHLDLNTKEYVEDRTGTIPSVKPEKASEFYSVFKNIEDQTDERNSKKEQLDDSSTQYKVDTNTLSDLPSDALDQLCKDIIEFRTKVVSIEKEKKMKSTYEESRRQRHQMQKVFDQIRKNHSGAKGSANTEEEDTNMEDEDEEDDTEDDLALEKRKEERDLEESNRRYEDMLHQLHSNTEPKIKSIRADIMSAENYEEHLEKNRSLYLKELLHLANDVHYDHHRSFKEQEERRDEEDRAKNGNAKELAPIQLSDGKAISAGKAAAITLPEGTVKSENYNADKNVSESSEHVKIKFDFKKAIDHSVESSSEDEGYRESELPPTKPSERSAAEDRLPFTADELNIRLTNLKESRYVDELVREFLGVYEDELVEYILENIRVNQSKQALLNELRETFDEDGETIADRLWSRKEFRLGT

Entity 9 Entity 9 polymer

Description description	Small nuclear ribonucleoprotein-associated protein B
Molecular weight formula_weight	22427.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK

Entity 10 Entity 10 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	16296.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL

Entity 11 Entity 11 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	12876.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSSQIIDRPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTPVE

Entity 12 Entity 12 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	11240.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR

Entity 13 Entity 13 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10385.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD

Entity 14 Entity 14 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9669.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN

Entity 15 Entity 15 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8490.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI

Entity 16 Entity 16 polymer

Description description	U1 snRNA
Molecular weight formula_weight	182114.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R

AUACUUACCUUAAGAUAUCAGAGGAGAUCAAGAAGUCCUACUGAUCAAACAUGCGCUUCCAAUAGUAGAAGGACGUUAAGCAUUUAUCAUUGAACUAUAAUUGUUCAUUGAAGUCAUUGAUGCAAACUCCUUGGUCACACACACAUACGGCGCGGAAGGCGUGUUUGCUGACGUUUCCAUUCCCUUGUUUCAAUCAUUGGUUAAUCCCUUGAUUCCUUUGGGGAUUUUUGGGUUAAACUGAUUUUUGGGGCCCUUUGUUUCUUCUGCCUGGAGAAGUUUGACACCAAAUUCAAAUUGGUGUUAGGGGAGCUGGGGCCUUUCAAAAGAGAGCUUUGUAGAGGCAUUCUUUUUGACUACUUUUCUCUAGCGUGCCAUUUUAGUUUUUGACGGCAGAUUCGAAUGAACUUAAGUUUAUGAUGAAGGUAUGGCUGUUGAGAUUAUUUGGUCGGGAUUGUAGUUUGAAGAUGUGCUCUUUUGAGCAGUCUCAACUUUGCUCGUUCCCGUUAUGGGAAAAAUUUUGGAAGGUCUUGGUAGGAACGGGUGGAUCUUAUAAUUUUUGAUUUAUUUU

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	6n7xA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	6n7xM00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6n7xN00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6n7xO00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6n7xP00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	6n7xQ00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

▶

Resolution resolution	3.600 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	352900

S. cerevisiae U1 snRNP

1. Protein Identity and Related Structures Protein Identity & Related Structures

U1 small nuclear ribonucleoprotein 70 kDa homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein component PRP42

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing factor 39

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein NAM8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

56 kDa U1 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein component SNU71

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein-associated protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer