SAXSdb — 4mpa

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Na(+)/H(+) exchange regulatory cofactor NHE-RF1, C-X-C chemokine receptor type 2 chimera

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 11–94	Fragment：SEE REMARK 999	ACY ACETIC ACID × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 4.8；293 K；100 mM sodium acetate, pH 4.8, 0.2 M ammonium acetate, 24% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.10 Å R-free 0.157

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4MPA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1G9O FIRST PDZ DOMAIN OF THE HUMAN NA+/H+ EXCHANGER REGULATORY FACTOR Deposited 2000-11-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–99（89 aa） Fragment：PDZ1 DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；291 K；potassium sodium tartrate, sodium citrate, ammonium sulfate, manganese chloride, pH 5.9, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.50 Å R-free 0.201
1GQ4 STRUCTURAL DETERMINANTS OF THE NHERF INTERACTION WITH BETA2AR AND PDGFR Deposited 2001-11-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–94（84 aa） Fragment：PDZ1 DOMAIN, RESIDUES 11-94	Not recorded	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.24；CITRIC ACID, LITHIUM CHLORIDE, pH 4.24	Resolution 1.90 Å R-free 0.186
1GQ5 Structural Determinants of the NHERF Interaction with beta2-AR and PDGFR Deposited 2001-11-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–94（84 aa） Fragment：PDZ1 DOMAIN, RESIDUES 11-94	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；SODIUM ACETATE, SODIUM CHLORIDE, pH 4.60	Resolution 2.20 Å R-free 0.263
1I92 STRUCTURAL BASIS OF THE NHERF PDZ1-CFTR INTERACTION Deposited 2001-03-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–94（84 aa） Fragment：PDZ1 DOMAIN (RESIDUES 11-94)	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；291 K；Sodium Acetate, Sodium Chloride, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.70 Å R-free 0.217
1SGH Moesin FERM domain bound to EBP50 C-terminal peptide Deposited 2004-02-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 321–358（38 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；Tris, PEG 4000, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.401
2D10 Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail peptide Deposited 2005-08-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 330–357（28 aa） Fragment：residues 331-358	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；10% PEG4000, 5% Isopropanol, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.50 Å R-free 0.268
2D10 Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail peptide Deposited 2005-08-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 330–357（28 aa） Fragment：residues 331-358	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；10% PEG4000, 5% Isopropanol, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.50 Å R-free 0.268
2D10 Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail peptide Deposited 2005-08-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 330–357（28 aa） Fragment：residues 331-358	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；10% PEG4000, 5% Isopropanol, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.50 Å R-free 0.268
2D10 Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail peptide Deposited 2005-08-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 330–357（28 aa） Fragment：residues 331-358	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；10% PEG4000, 5% Isopropanol, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.50 Å R-free 0.268
2JXO Structure of the second PDZ domain of NHERF-1 Deposited 2007-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 150–240（91 aa） Fragment：PDZ 2 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；288.1 K；Ionic strength (raw mmCIF value) 0.15；Pressure ambient NMR sample composition 1 mM PDZ2, HEPES, DTT, H2O, DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1 mM [U-100% 15N] PDZ2, HEPES, DTT, H2O, DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] PDZ2, HEPES, DTT, H2O, DSS, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KJD Solution structure of extended PDZ2 domain from NHERF1 (150-270) Deposited 2009-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 150–270（121 aa） Fragment：Extended PDZ2 domain: UNP residues 150-270	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；303 K；Ionic strength (raw mmCIF value) 0.150；Pressure ambient NMR sample composition 550 uM [U-100% 13C; U-100% 15N] PDZ2-270-1, 20 mM HEPES-2, 0.5 mM DTT-3, 0.1 mM PMSF-4, 150 mM sodium chloride-5, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KRG Solution Structure of human sodium/ hydrogen exchange regulatory factor 1(150-358) Deposited 2009-12-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 150–358（209 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；303 K；Pressure ambient NMR sample composition 557 uM [U-100% 13C; U-100% 15N] NHERF1 (150-358), 20 mM HEPES, 150 mM sodium chloride, 0.5 mM DTT, 0.1 mM PMSF, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 389 uM [U-100% 13C; U-100% 15N; U-80% 2H] NHERF1 (150-358), 20 mM HEPES, 150 mM sodium chloride, 0.5 mM DTT, 0.1 mM PMSF, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 413 uM [U-100% 13C; U-100% 15N]-Leu,Val,Phe NHERF1 (150-358), 20 mM HEPES, 150 mM sodium chloride, 0.5 mM DTT, 0.1 mM PMSF, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2M0T Structural characterization of the extended PDZ1 domain from NHERF1 Deposited 2012-11-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–120（110 aa） Fragment：PDZ1 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；288 K；Ionic strength (raw mmCIF value) 150；Pressure ambient NMR sample composition 400 uM [U-99% 13C; U-99% 15N] PDZ1, 20 mM TRIS, 150 mM sodium chloride, 0.5 mM DTT, 0.5 mM EDTA, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2M0U Complex structure of C-terminal CFTR peptide and extended PDZ1 domain from NHERF1 Deposited 2012-11-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–120（110 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；288 K；Ionic strength (raw mmCIF value) 150；Pressure ambient NMR sample composition 286 uM [U-99% 13C; U-99% 15N] PDZ1, 20 mM TRIS, 150 mM sodium chloride, 0.5 mM DTT, 0.5 mM EDTA, 275 uM CFTR, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2M0V Complex structure of C-terminal CFTR peptide and extended PDZ2 domain from NHERF1 Deposited 2012-11-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 150–270（121 aa） Fragment：PDZ2 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；288 K；Ionic strength (raw mmCIF value) 150；Pressure ambient NMR sample composition 400 uM [U-99% 13C; U-99% 15N] PDZ2, 20 mM TRIS, 150 mM sodium chloride, 0.5 mM DTT, 0.5 mM EDTA, 688 uM CFTR, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 200 uM [U-99% 13C; U-99% 15N] PDZ2, 20 mM TRIS, 150 mM sodium chloride, 0.5 mM DTT, 0.5 mM EDTA, 275 uM CFTR, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2OZF The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1) Deposited 2007-02-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 150–235（86 aa） Fragment：Second PDZ domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；0.2M NaNO3, 0.1M BTProp, 20% PEG 3350, 10% Ethylene glycol, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.50 Å R-free 0.211
4JL7 Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain of NHERF1 Deposited 2013-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–95（85 aa） Fragment：unp residues 11-95	Not recorded	CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；100 mM sodium acetate, 2.7 M sodium chloride, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.16 Å R-free 0.208
4LMM Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21 space group Deposited 2013-07-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–94（84 aa） Fragment：UNP residues 11-95	Not recorded	ACY ACETIC ACID × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；293 K；100 mM sodium acetate, 0.2 M ammonium acetate, 24% PEG4000, pH 4.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.10 Å R-free 0.217
4N6X Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain of NHERF1 Deposited 2013-10-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–94（84 aa） Fragment：First PDZ Domain (UNP residues 11-94)	Not recorded	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；100 mM sodium acetate, pH 4.6, 2.7 M sodium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.05 Å R-free 0.163
4PQW Crystal Structure of Phospholipase C beta 3 in Complex with PDZ1 of NHERF1 Deposited 2014-03-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–94（84 aa） Fragment：unp residues 11-94	Not recorded	CL CHLORIDE ION × 4 NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；100 mM sodium acetate, pH 4.6, 2.5 M sodium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.47 Å R-free 0.196
4Q3H The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric protein Deposited 2014-04-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 150–234（85 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；100 mM Tris HCl, pH 8.5, 8% PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.44 Å R-free 0.195
4Q3H The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric protein Deposited 2014-04-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 150–234（85 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；100 mM Tris HCl, pH 8.5, 8% PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.44 Å R-free 0.195
6RQR Extended NHERF1 PDZ2 domain in complex with the PDZ-binding motif of CFTR Deposited 2019-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 150–269（120 aa） Chain B 150–269（120 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；288 K；1.65 M ammonium sulphate, 100 mM tri-sodium citrate pH 5.6	Resolution 2.20 Å R-free 0.233
9RXQ Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (KSTQF) of human URAT1 transporter (SLC22A12) Deposited 2025-07-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–94（84 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.4；293 K；100 mM sodium acetate pH 4.8 200 mM ammonium acetate 24% PEG 4000	Resolution 1.38 Å R-free 0.183
9RXQ Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (KSTQF) of human URAT1 transporter (SLC22A12) Deposited 2025-07-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 11–94（84 aa）	Not recorded	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.4；293 K；100 mM sodium acetate pH 4.8 200 mM ammonium acetate 24% PEG 4000	Resolution 1.38 Å R-free 0.183
9RXT Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (NATRL) of the human sodium-dependent phosphate transporter 2A (NaPi-IIa, SLC34A1) Deposited 2025-07-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 11–94（84 aa）	Not recorded	TOE 2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXYL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；293 K；100mM Bicine pH 9, 100mM NaCl, 30% PEG 550 MME	Resolution 1.36 Å R-free 0.198

21 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NHRF1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–86； UniProt 11–94

Na(+)/H(+) exchange regulatory cofactor NHE-RF1, C-X-C chemokine receptor type 2 chimera

Homo sapiens

UniProt P25025

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 356–360	Fragment：SEE REMARK 999	ACY ACETIC ACID × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 4.8；293 K；100 mM sodium acetate, pH 4.8, 0.2 M ammonium acetate, 24% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.10 Å R-free 0.157

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4MPA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4Q3H The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric protein Deposited 2014-04-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 356–360（5 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；100 mM Tris HCl, pH 8.5, 8% PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.44 Å R-free 0.195
4Q3H The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric protein Deposited 2014-04-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 356–360（5 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；100 mM Tris HCl, pH 8.5, 8% PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.44 Å R-free 0.195
5TYT Crystal Structure of the PDZ domain of RhoGEF bound to CXCR2 C-terminal peptide Deposited 2016-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 356–360（5 aa） Fragment：Rho (UNP residues 41-123), CXCR2 C-terminal peptide (UNP residues 356-360) Chain B 356–360（5 aa） Fragment：Rho (UNP residues 41-123), CXCR2 C-terminal peptide (UNP residues 356-360)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；25% PEG8000, 0.1 M sodium citrate, 0.2 M sodium acetate	Resolution 2.40 Å R-free 0.240
5TYT Crystal Structure of the PDZ domain of RhoGEF bound to CXCR2 C-terminal peptide Deposited 2016-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 356–360（5 aa） Fragment：Rho (UNP residues 41-123), CXCR2 C-terminal peptide (UNP residues 356-360) Chain D 356–360（5 aa） Fragment：Rho (UNP residues 41-123), CXCR2 C-terminal peptide (UNP residues 356-360)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；25% PEG8000, 0.1 M sodium citrate, 0.2 M sodium acetate	Resolution 2.40 Å R-free 0.240
6KVA Structure of anti-hCXCR2 abN48-2 in complex with its CXCR2 epitope Deposited 2019-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 9–19（11 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M HEPES pH 7.5, 25% w/v Polyethylene glycol 3350	Resolution 2.20 Å R-free 0.234
6KVA Structure of anti-hCXCR2 abN48-2 in complex with its CXCR2 epitope Deposited 2019-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain b 9–19（11 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M HEPES pH 7.5, 25% w/v Polyethylene glycol 3350	Resolution 2.20 Å R-free 0.234
6KVF Structure of anti-hCXCR2 abN48 in complex with its CXCR2 epitope Deposited 2019-09-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain b 9–19（11 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M HEPES sodium pH 7.5, 2% v/v Polyethylene glycol 400, 2.0M Ammonium sulfate	Resolution 2.79 Å R-free 0.264
6KVF Structure of anti-hCXCR2 abN48 in complex with its CXCR2 epitope Deposited 2019-09-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 9–19（11 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M HEPES sodium pH 7.5, 2% v/v Polyethylene glycol 400, 2.0M Ammonium sulfate	Resolution 2.79 Å R-free 0.264
6LFL Crystal structure of a class A GPCR Deposited 2019-12-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 37–241（205 aa） Chain A 244–344（101 aa）	Mutation：L135W, A249E, G303A Mutation：L135W, A249E, G303A	EBX 4-[[3,4-bis(oxidanylidene)-2-[[(1~{R})-1-(4-propan-2-ylfuran-2-yl)propyl]amino]cyclobuten-1-yl]amino]-~{N},~{N}-dimethyl-3-oxidanyl-pyridine-2-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；293 K；100mM HEPES pH7.0, 32% PEG 400, 50-150 mM Sodium tartrate dibasic dihydrate salt	Resolution 3.20 Å R-free 0.264
6LFM Cryo-EM structure of a class A GPCR Deposited 2019-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 1–360（360 aa）	Not recorded	CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6LFO Cryo-EM structure of a class A GPCR monomer Deposited 2019-12-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 1–360（360 aa）	Not recorded	CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8XVU Structure of CXCR2 bound to CXCL2 (Ligand-receptor focused map) Deposited 2024-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
8XWA Structure of CXCR2 bound to CXCL1 (Ligand-receptor focused map) Deposited 2024-01-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.48 Å
8XWF Structure of CXCR2 bound to CXCL3 (Ligand-receptor focused map) Deposited 2024-01-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
8XWM Structure of CXCR2 bound to CXCL6 (Ligand-receptor focused map) Deposited 2024-01-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.71 Å
8XWN Structure of CXCR2 bound to CXCL8 (Ligand-receptor focused map) Deposited 2024-01-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
8XWS Structure of CXCR2 bound to CXCL5 (Ligand-receptor focused map) Deposited 2024-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 2–360（359 aa） Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.06 Å
8XWV Structure of CXCR2 bound to CXCL1 (CXCR2-CXCL1-Go Full map) Deposited 2024-01-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.07 Å
8XX3 Structure of CXCR2 bound to CXCL3 (CXCR2-CXCL3-Go Full map) Deposited 2024-01-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
8XX6 Structure of CXCR2 bound to CXCL8 (CXCR2-CXCL8-Go Full map) Deposited 2024-01-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.99 Å
8XX7 Structure of CXCR2 bound to CXCL5 (CXCR2-CXCL5-Go Full map) Deposited 2024-01-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 2–360（359 aa） Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8XXH Structure of CXCR2 bound to CXCL2 (CXCR2-CXCL2-Go Full map) Deposited 2024-01-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8XXR Structure of CXCR2 bound to CXCL6 (CXCR2-CXCL6-Go Full map) Deposited 2024-01-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
8XXX Structure of CXCR2 bound to CXCL6 (Composite map) Deposited 2024-01-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 2–360（359 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å

20 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CXCR2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 87–91； UniProt 356–360

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4mpa
Deposition date deposition_date	2013-09-12
Structure title title	Crystal structure of NHERF1-CXCR2 signaling complex in P21 space group
Keywords keywords	neutrophil, inflammatory diseases, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.33 Å
Radius of gyration Rg (electron density) rg_electron	13.20 Å
Forward intensity I(0) i0	2204250.00
Molecular weight molecular_weight	9942.0 kDa
Excluded volume excluded_volume	12401 Å³
Envelope volume envelope_volume	14827 Å³
Hydration-shell volume shell_volume	9999 Å³
Envelope diameter envelope_diameter	53.8 Å
Shell Rg shell_rg	18.42 Å
Envelope Rg envelope_rg	13.90 Å
Shape Rg shape_rg	13.16 Å
Total Rg total_rg	14.54 Å
Total atoms total_atoms	1404
Residues n_residues	91
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	52.6 Å
Rg (real space) rg_real	14.31 Å
Rg uncertainty (real space) rg_real_error	0.52 Å
I(0) (real space) i0_real	2.2040e+06
I(0) uncertainty (real space) i0_real_error	3.2110e+04
Rg (reciprocal space) rg_reciprocal	14.31 Å
I(0) (reciprocal space) i0_reciprocal	2204000.0000
Solution quality estimate total_estimate	0.7296
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	18.6 Å
Skewness Skewness skewness	0.403
Kurtosis Kurtosis kurtosis	0.269
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	402800.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.510; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.953; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Na(+)/H(+) exchange regulatory cofactor NHE-RF1, C-X-C chemokine receptor type 2 chimera
Molecular weight formula_weight	9860.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1622

GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETSTTL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ACETIC ACID
Molecular weight formula_weight	60.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	158

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4mpaa1
Class class	b — All beta proteins
Fold Fold fold	b.36 — PDZ domain-like
Superfamily Superfamily superfamily	b.36.1 — PDZ domain-like
Family Family family	b.36.1.1 — PDZ domain

Domain ID domain_id	d4mpaa2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	4mpaA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	26.593 Å
Unit-cell length b length_b	45.509 Å
Unit-cell length c length_c	33.446 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	109.71 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.097 Å
Low-resolution limit resolution_low	25.893 Å
R factor r_factor	0.1441
R_work r_work	0.1434
R_free r_free	0.1569

fit	/app/data/saxs_computation/mp/4mpa/4mpa.fit
pddf	/app/data/pr_computation/mp/4mpa/4mpa.pr.out
profile	/app/data/saxs_computation/mp/4mpa/4mpa.dat

Crystal structure of NHERF1-CXCR2 signaling complex in P21 space group

1. Protein Identity and Related Structures Protein Identity & Related Structures

Na(+)/H(+) exchange regulatory cofactor NHE-RF1, C-X-C chemokine receptor type 2 chimera

State in the Current Structure

Other States of the Same Protein in the Database

Na(+)/H(+) exchange regulatory cofactor NHE-RF1, C-X-C chemokine receptor type 2 chimera

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)