SAXSdb — 4nzd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-21 receptor

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Monomer Protein × 1 其他Polymer 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 20–232	Not recorded	;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 MAN alpha-D-mannopyranose × 1 NA SODIUM ION × 3 CL CHLORIDE ION × 4 TLA L(+)-TARTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
2	Other combination Monomer Protein × 1 其他Polymer 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 20–232	Not recorded	;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 MAN alpha-D-mannopyranose × 1 CL CHLORIDE ION × 5 TLA L(+)-TARTARIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
3	Other combination Monomer Protein × 1 其他Polymer 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain C； UniProt 20–232	Not recorded	;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 MAN alpha-D-mannopyranose × 1 NA SODIUM ION × 2 CL CHLORIDE ION × 2 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4	Other combination Homooligomer Protein × 6 其他Polymer 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 20–232 Chain B； UniProt 20–232 Chain C； UniProt 20–232	Not recorded	;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 6 MAN alpha-D-mannopyranose × 6 NA SODIUM ION × 10 CL CHLORIDE ION × 22 TLA L(+)-TARTARIC ACID × 6 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4NZD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
6PLH FAB fragment complexed with C-mannosylated tryptophan peptide Deposited 2019-06-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 202–232（31 aa） Fragment：UNP Residues 202-232	Not recorded	PO4 PHOSPHATE ION × 1 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；25% (w/v) polyethylene glycol 1500, 0.1 M succinate-phosphate-glycine, pH 7.0	Resolution 1.60 Å R-free 0.221
7KQ7 Crystal structure of IL21R in complex with an antibody Fab fragment Deposited 2020-11-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–233（214 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；300 K；10% PEG MME 5000 and 0.1M MES, pH 6.5	Resolution 2.20 Å R-free 0.240
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242

5 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL21R_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–213； UniProt 20–232 Author chain B； PDBConstruct 1–213； UniProt 20–232 Author chain C； PDBConstruct 1–213； UniProt 20–232

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4nzd
Deposition date deposition_date	2013-12-12
Structure title title	Interleukin 21 receptor
Keywords keywords	Fibronectine III domain, Interleukin 21, Glycosylated, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	33.53 Å
Radius of gyration Rg (electron density) rg_electron	33.01 Å
Forward intensity I(0) i0	98345300.00
Molecular weight molecular_weight	76035.0 kDa
Excluded volume excluded_volume	93946 Å³
Envelope volume envelope_volume	142840 Å³
Hydration-shell volume shell_volume	37268 Å³
Envelope diameter envelope_diameter	135.0 Å
Shell Rg shell_rg	37.81 Å
Envelope Rg envelope_rg	33.69 Å
Shape Rg shape_rg	33.02 Å
Total Rg total_rg	33.41 Å
Total atoms total_atoms	5332
Residues n_residues	628
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	128.2 Å
Rg (real space) rg_real	33.56 Å
Rg uncertainty (real space) rg_real_error	1.44 Å
I(0) (real space) i0_real	9.8350e+07
I(0) uncertainty (real space) i0_real_error	1.6700e+06
Rg (reciprocal space) rg_reciprocal	33.54 Å
I(0) (reciprocal space) i0_reciprocal	98340000.0000
Solution quality estimate total_estimate	0.7487
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	40.9 Å
Skewness Skewness skewness	0.372
Kurtosis Kurtosis kurtosis	-0.185
Angular range angular_range	— – 0.2350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	17400000.0000
Real-space data points n_real_points	48
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.648; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.784; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Interleukin-21 receptor
Molecular weight formula_weight	25451.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	5498

CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	homo sapiens

Entity 2 Entity 2 branched

Description description	;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	894.8 kDa
Source method src_method	man
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	alpha-D-mannopyranose
Molecular weight formula_weight	180.2 kDa
Source method src_method	man
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 6 Entity 6 non-polymer

Description description	L(+)-TARTARIC ACID
Molecular weight formula_weight	150.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 7 Entity 7 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	158

▼

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	4nzdA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4nzdB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4nzdB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	4nzdC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	114.330 Å
Unit-cell length b length_b	125.260 Å
Unit-cell length c length_c	178.270 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	29.778 Å
R factor r_factor	0.2407
R_work r_work	0.2386
R_free r_free	0.2749

fit	/app/data/saxs_computation/nz/4nzd/4nzd.fit
pddf	/app/data/pr_computation/nz/4nzd/4nzd.pr.out
profile	/app/data/saxs_computation/nz/4nzd/4nzd.dat

Interleukin 21 receptor