SAXSdb — 7kq7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-21 receptor

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 20–233	Not recorded	Antibody heavy chain × 1 Antibody light chain × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；300 K；10% PEG MME 5000 and 0.1M MES, pH 6.5	Resolution 2.20 Å R-free 0.240

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7KQ7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 NA SODIUM ION × 3 CL CHLORIDE ION × 4 TLA L(+)-TARTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 CL CHLORIDE ION × 5 TLA L(+)-TARTARIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 NA SODIUM ION × 2 CL CHLORIDE ION × 2 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 20–232（213 aa） Chain B 20–232（213 aa） Chain C 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 6 NA SODIUM ION × 10 CL CHLORIDE ION × 22 TLA L(+)-TARTARIC ACID × 6 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
6PLH FAB fragment complexed with C-mannosylated tryptophan peptide Deposited 2019-06-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 202–232（31 aa） Fragment：UNP Residues 202-232	Not recorded	PO4 PHOSPHATE ION × 1 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；25% (w/v) polyethylene glycol 1500, 0.1 M succinate-phosphate-glycine, pH 7.0	Resolution 1.60 Å R-free 0.221
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242

5 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL21R_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–214； UniProt 20–233

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7kq7
Deposition date deposition_date	2020-11-13
Structure title title	Crystal structure of IL21R in complex with an antibody Fab fragment
Keywords keywords	cytokine receptor, PROTEIN BINDING, PROTEIN BINDING-Immune System complex; PROTEIN BINDING/Immune System
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	33.05 Å
Radius of gyration Rg (electron density) rg_electron	33.18 Å
Forward intensity I(0) i0	81167400.00
Molecular weight molecular_weight	70433.0 kDa
Excluded volume excluded_volume	87596 Å³
Envelope volume envelope_volume	116450 Å³
Hydration-shell volume shell_volume	32070 Å³
Envelope diameter envelope_diameter	122.6 Å
Shell Rg shell_rg	36.43 Å
Envelope Rg envelope_rg	33.22 Å
Shape Rg shape_rg	33.18 Å
Total Rg total_rg	33.46 Å
Total atoms total_atoms	4962
Residues n_residues	637
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	116.2 Å
Rg (real space) rg_real	33.45 Å
Rg uncertainty (real space) rg_real_error	1.15 Å
I(0) (real space) i0_real	8.1170e+07
I(0) uncertainty (real space) i0_real_error	1.5200e+06
Rg (reciprocal space) rg_reciprocal	33.28 Å
I(0) (reciprocal space) i0_reciprocal	81160000.0000
Solution quality estimate total_estimate	0.8310
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	33.9 Å
Skewness Skewness skewness	0.575
Kurtosis Kurtosis kurtosis	-0.187
Angular range angular_range	— – 0.2400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	9408000.0000
Real-space data points n_real_points	49
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.746; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.716; Smooth: 0.845

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Antibody heavy chain
Molecular weight formula_weight	23848.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H
Atom count atom_count	5111

EVQLVESGGGLVQPGRSLRLSCAASGVTFSDYHMAWVRQAPKKGLEWVATIIYDAARTYYRDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATWQTTGTPGWFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

来源 Source

来源生物 organism	Rattus norvegicus
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Cricetulus griseus

Entity 2 Entity 2 polymer

Description description	Antibody light chain
Molecular weight formula_weight	23777.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

DIQMTQSPSSLSASVGDRVTITCGASQSVSISRFNLMHWYQQKPGHQPKLLIYRASNLASGVPSRFSGSGSGTDFTLTINPLQAEDFATYYCQQSRESPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

来源 Source

来源生物 organism	Rattus norvegicus
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Cricetulus griseus

Entity 3 Entity 3 polymer

Description description	Interleukin-21 receptor
Molecular weight formula_weight	24636.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Cricetulus griseus

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	149

▼

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d7kq7h_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d7kq7l1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d7kq7l2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

CATH v4.4 (4 domains)

Domain ID domain_id	7kq7H01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7kq7H02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7kq7L01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7kq7L02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	155.482 Å
Unit-cell length b length_b	246.501 Å
Unit-cell length c length_c	55.063 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.203 Å
Low-resolution limit resolution_low	42.216 Å
R factor r_factor	0.2161
R_work r_work	0.2148
R_free r_free	0.2404

fit	/app/data/saxs_computation/kq/7kq7/7kq7.fit
pddf	/app/data/pr_computation/kq/7kq7/7kq7.pr.out
profile	/app/data/saxs_computation/kq/7kq7/7kq7.dat

Crystal structure of IL21R in complex with an antibody Fab fragment

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-21 receptor

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)