8ent

Interleukin-21 signaling complex with IL-21R and IL-2Rg

Method: X-RAY DIFFRACTION D_max: 198.5 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-21

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 3 其他Polymer 2 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 30–162	Mutation：N68Q	Interleukin-21 receptor × 1 （Q9HBE5） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain D； UniProt 30–162	Mutation：N68Q	Interleukin-21 receptor × 1 （Q9HBE5） Cytokine receptor common subunit gamma × 1 （P31785） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
3	Other combination Heteromer Protein × 3 其他Polymer 1 PDB declaration: trimeric（3） Consistent with protein copy count	Chain G； UniProt 30–162	Mutation：N68Q	Interleukin-21 receptor × 1 （Q9HBE5） Cytokine receptor common subunit gamma × 1 （P31785） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
4	Other combination Heteromer Protein × 2 其他Polymer 1 PDB declaration: dimeric（2） Consistent with protein copy count	Chain J； UniProt 30–162	Mutation：N68Q	Interleukin-21 receptor × 1 （Q9HBE5） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ENT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2OQP Solution structure of human interleukin-21 Deposited 2007-02-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23–155（133 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；300 K；Ionic strength (raw mmCIF value) 50mM NaCl；Pressure ambient NMR sample composition 0.8mM IL21 U-15N, 20mM phosphate, 50mM NaCl, 1mM NaN3 \| 90% H2O/10% D2O NMR sample composition 0.8mM IL21 U-15N,13C, 20mM phosphate, 50mM NaCl, 1mM NaN3 \| 100% D2O	Resolution not provided
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–155（133 aa） Fragment：unp RESIDUES 23-155	Not recorded	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 23–155（133 aa） Fragment：unp RESIDUES 23-155	Not recorded	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 23–155（133 aa） Fragment：unp RESIDUES 23-155	Not recorded	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 23–155（133 aa） Fragment：unp RESIDUES 23-155	Not recorded	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 23–155（133 aa） Fragment：unp RESIDUES 23-155	Not recorded	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 23–155（133 aa） Fragment：unp RESIDUES 23-155	Not recorded	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain N 23–155（133 aa） Fragment：unp RESIDUES 23-155	Not recorded	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain P 23–155（133 aa） Fragment：unp RESIDUES 23-155	Not recorded	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273

2 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL21_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–133； UniProt 30–162 Author chain D； PDBConstruct 1–133； UniProt 30–162 Author chain G； PDBConstruct 1–133； UniProt 30–162 Author chain J； PDBConstruct 1–133； UniProt 30–162

Interleukin-21 receptor

Homo sapiens

UniProt Q9HBE5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 3 其他Polymer 2 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 20–229	Mutation：N78Q, N85Q, N106D, N116Q	Interleukin-21 × 1 （Q9HBE4） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain E； UniProt 20–229	Mutation：N78Q, N85Q, N106D, N116Q	Interleukin-21 × 1 （Q9HBE4） Cytokine receptor common subunit gamma × 1 （P31785） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
3	Other combination Heteromer Protein × 3 其他Polymer 1 PDB declaration: trimeric（3） Consistent with protein copy count	Chain H； UniProt 20–229	Mutation：N78Q, N85Q, N106D, N116Q	Interleukin-21 × 1 （Q9HBE4） Cytokine receptor common subunit gamma × 1 （P31785） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
4	Other combination Heteromer Protein × 2 其他Polymer 1 PDB declaration: dimeric（2） Consistent with protein copy count	Chain K； UniProt 20–229	Mutation：N78Q, N85Q, N106D, N116Q	Interleukin-21 × 1 （Q9HBE4） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8ENT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 NA SODIUM ION × 3 CL CHLORIDE ION × 4 TLA L(+)-TARTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 CL CHLORIDE ION × 5 TLA L(+)-TARTARIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 NA SODIUM ION × 2 CL CHLORIDE ION × 2 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 20–232（213 aa） Chain B 20–232（213 aa） Chain C 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 6 NA SODIUM ION × 10 CL CHLORIDE ION × 22 TLA L(+)-TARTARIC ACID × 6 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
6PLH FAB fragment complexed with C-mannosylated tryptophan peptide Deposited 2019-06-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 202–232（31 aa） Fragment：UNP Residues 202-232	Not recorded	PO4 PHOSPHATE ION × 1 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；25% (w/v) polyethylene glycol 1500, 0.1 M succinate-phosphate-glycine, pH 7.0	Resolution 1.60 Å R-free 0.221
7KQ7 Crystal structure of IL21R in complex with an antibody Fab fragment Deposited 2020-11-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–233（214 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；300 K；10% PEG MME 5000 and 0.1M MES, pH 6.5	Resolution 2.20 Å R-free 0.240
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242

5 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL21R_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–210； UniProt 20–229 Author chain E； PDBConstruct 1–210； UniProt 20–229 Author chain H； PDBConstruct 1–210； UniProt 20–229 Author chain K； PDBConstruct 1–210； UniProt 20–229

Cytokine receptor common subunit gamma

Homo sapiens

UniProt P31785

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 3 其他Polymer 2 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 55–254	Mutation：N53Q	Interleukin-21 × 1 （Q9HBE4） Interleukin-21 receptor × 1 （Q9HBE5） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain F； UniProt 55–254	Mutation：N53Q	Interleukin-21 × 1 （Q9HBE4） Interleukin-21 receptor × 1 （Q9HBE5） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
3	Other combination Heteromer Protein × 3 其他Polymer 1 PDB declaration: trimeric（3） Consistent with protein copy count	Chain I； UniProt 55–254	Mutation：N53Q	Interleukin-21 × 1 （Q9HBE4） Interleukin-21 receptor × 1 （Q9HBE5） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8ENT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2B5I cytokine receptor complex Deposited 2005-09-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 56–254（199 aa）	Mutation：N53Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；293 K；29% Pentaerythritol Ethoxylate 15/4; 50 mM Ammonium Sulfate; 50 mM Bis Tris, pH 6.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.30 Å R-free 0.269
2ERJ Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 23–255（233 aa）	Mutation：N58Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.1；295.5 K；MPEG 550, sodium acetate, sodium citrate, phenol, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 3.00 Å R-free 0.263
2ERJ Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 23–255（233 aa）	Mutation：N58Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.1；295.5 K；MPEG 550, sodium acetate, sodium citrate, phenol, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 3.00 Å R-free 0.263
3BPL Crystal structure of the IL4-IL4R-Common Gamma ternary complex Deposited 2007-12-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 56–254（199 aa） Fragment：Extracellular domain, residues 56-254	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；10% PEG8K, 8% ethylene glycol, 0.1M HEPES pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.93 Å R-free 0.297
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain d 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain g 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 12 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain j 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain O 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain U 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain X 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain a 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QB7 Interleukin-4 mutant RGA bound to cytokine receptor common gamma Deposited 2011-01-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 55–254（200 aa） Fragment：UNP residues 55-254	Mutation：N53Q	SO4 SULFATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.3；298 K；100 mM (NH4)2SO4, 100 mM Cacodylate, 20% PEG-3350, pH 6.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.25 Å R-free 0.292
3QB7 Interleukin-4 mutant RGA bound to cytokine receptor common gamma Deposited 2011-01-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 55–254（200 aa） Fragment：UNP residues 55-254	Mutation：N53Q	SO4 SULFATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.3；298 K；100 mM (NH4)2SO4, 100 mM Cacodylate, 20% PEG-3350, pH 6.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.25 Å R-free 0.292
4GS7 Structure of the Interleukin-15 quaternary complex Deposited 2012-08-27	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 55–254（200 aa）	Mutation：N75Q Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 1 ACT ACETATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.75；298 K；22.5% PEG3350, 0.1M BIS-TRIS propane, 0.2M sodium acetate, pH 8.75, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.35 Å R-free 0.227
5M5E Crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor Deposited 2016-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 23–262（240 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4 CYS CYSTEINE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.1M HEPES, pH 7.0, 2M ammonium sulfate	Resolution 2.30 Å R-free 0.235
6OEL Engineered Fab bound to IL-4 receptor Deposited 2019-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 61–249（189 aa） Fragment：UNP residues 61-249	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；295 K；22.5% PurePEG (Microlytic), 0.1 M sodium citrate, pH 5.5, 0.6 M ammonium nitrate	Resolution 3.10 Å R-free 0.256
7S2R nanobody bound to IL-2Rg Deposited 2021-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 55–254（200 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SO4 SULFATE ION × 8 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；295 K；2M ammonium sulfate, 0.2M BIS-Tris pH5.5	Resolution 2.49 Å R-free 0.271
8EPA Structure of interleukin receptor common gamma chain (IL2Rgamma) in complex with two antibodies Deposited 2022-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 23–262（240 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 55–254（200 aa） Fragment：residues 55-254	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 55–254（200 aa） Fragment：residues 55-254	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9JQT Structure of interleukin receptor common gamma chain (IL2Rgamma/CD132) in complex with 2D4 Deposited 2024-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 23–262（240 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9KMC Cryo-EM structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 and anti-CD25 Fab S417 Deposited 2024-11-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 23–255（233 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å

13 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL2RG_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 2–201； UniProt 55–254 Author chain F； PDBConstruct 2–201； UniProt 55–254 Author chain I； PDBConstruct 2–201； UniProt 55–254

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ent
Deposition date deposition_date	2022-09-30
Structure title title	Interleukin-21 signaling complex with IL-21R and IL-2Rg
Keywords keywords	IL-21, receptor, complex, signaling, CYTOKINE, CYTOKINE-CYTOKINE RECEPTOR complex; CYTOKINE/CYTOKINE RECEPTOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	55.58 Å
Radius of gyration Rg (electron density) rg_electron	55.88 Å
Forward intensity I(0) i0	744706000.00
Molecular weight molecular_weight	224140.0 kDa
Excluded volume excluded_volume	278700 Å³
Envelope volume envelope_volume	436790 Å³
Hydration-shell volume shell_volume	67715 Å³
Envelope diameter envelope_diameter	211.7 Å
Shell Rg shell_rg	56.38 Å
Envelope Rg envelope_rg	54.14 Å
Shape Rg shape_rg	55.82 Å
Total Rg total_rg	56.09 Å
Total atoms total_atoms	15780
Residues n_residues	1888
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	198.5 Å
Rg (real space) rg_real	55.87 Å
Rg uncertainty (real space) rg_real_error	2.78 Å
I(0) (real space) i0_real	7.4470e+08
I(0) uncertainty (real space) i0_real_error	1.6380e+07
Rg (reciprocal space) rg_reciprocal	55.33 Å
I(0) (reciprocal space) i0_reciprocal	744100000.0000
Solution quality estimate total_estimate	0.8531
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	70.9 Å
Skewness Skewness skewness	0.429
Kurtosis Kurtosis kurtosis	-0.202
Angular range angular_range	— – 0.1400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	32080000.0000
Real-space data points n_real_points	29
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.803; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.909; Smooth: 0.769

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Interleukin-21
Molecular weight formula_weight	16704.0 kDa
Mutation mutation	N68Q
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J
Atom count atom_count	15852

QGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIIQVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDSGAPGSHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Interleukin-21 receptor
Molecular weight formula_weight	27465.5 kDa
Mutation mutation	N78Q, N85Q, N106D, N116Q
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K

CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEEKAASGRGLNDIFEAQKIEWHEHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Cytokine receptor common subunit gamma
Molecular weight formula_weight	24951.8 kDa
Mutation mutation	N53Q
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I

PLPLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Trichoplusia ni

Entity 4 Entity 4 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	3

Entity 5 Entity 5 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 7 Entity 7 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	nat
Copy count entity_count	14

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	55

▶

8. Citations (1)

▶

Unit-cell length a length_a	66.167 Å
Unit-cell length b length_b	66.464 Å
Unit-cell length c length_c	162.684 Å
Unit-cell angle α angle_alpha	83.34 °
Unit-cell angle β angle_beta	83.71 °
Unit-cell angle γ angle_gamma	73.10 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.830 Å
Low-resolution limit resolution_low	48.170 Å
R factor r_factor	0.2551
R_work r_work	0.2536
R_free r_free	0.2997

fit	/app/data/saxs_computation/en/8ent/8ent.fit
pddf	/app/data/pr_computation/en/8ent/8ent.pr.out
profile	/app/data/saxs_computation/en/8ent/8ent.dat

Interleukin-21 signaling complex with IL-21R and IL-2Rg

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-21

State in the Current Structure

Other States of the Same Protein in the Database

Interleukin-21 receptor

State in the Current Structure

Other States of the Same Protein in the Database

Cytokine receptor common subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)